KEGG   Burkholderia cepacia ATCC 25416: APZ15_15920Help
Entry
APZ15_15920       CDS       T04772                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00010  Glycolysis / Gluconeogenesis
bcep00020  Citrate cycle (TCA cycle)
bcep00620  Pyruvate metabolism
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01120  Microbial metabolism in diverse environments
bcep01130  Biosynthesis of antibiotics
bcep01200  Carbon metabolism
Module
bcep_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APZ15_15920
   00020 Citrate cycle (TCA cycle)
    APZ15_15920
   00620 Pyruvate metabolism
    APZ15_15920
Enzymes [BR:bcep01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     APZ15_15920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H Biotin_lipoyl_2 RnfC_N HlyD_D23 NQRA HlyD_3 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ALK19169
UniProt: A0A088TBX7
LinkDB All DBs
Position
1:complement(3439302..3440945)
Genome map
AA seq 547 aa AA seqDB search
MSQAIEVKVPDIGDYKDVPVIEIGVKVGDTVEPEQSLVTLESDKATMDVPSPVGGVVKEI
KVKVGDSVSEGSLIILLEGGAAAQANGAAAPAAAPAPAAAPAPAAAAPVAAPAAAGGTLE
VKVPDIGDYKDVPVIEIGVKVGDTVEKEQSLVTLESDKATMDVPSPAAGVVKEIKVKVGD
SVSEGTLIVLLEAAGAAAAAPQASAPAPAAAAPAPTPAAAPAKAAPAAAAPAPAAAPSGE
YRASHASPSVRKFARELGVEVARVQGSGPKGRITKEDVTGFVKGVMTGQRAAPGAAAAPA
GGGELNLLPWPKVDFSKFGPFEAKPLSRIKKISGANLHRNWVMIPHVTNNDEADITELEA
LRVQLNKEHEKAGVKFTMLAFVIKAVVAALKKFPTFNASLDGDNLVFKQYYHIGFAADTP
NGLVVPVIRDADKKGLVDIAKEMAELSKAARDGKLKPDQMQGGCFSISSLGGIGGTNFTP
IINAPEVAILGLSRGQMKPVWDGKQFVPRLTLPLSLSYDHRVIDGAEAARFNAYLGALLA
DFRRIIL
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaagcgatcgaagtgaaggtgccggatatcggcgattacaaggacgtgccggtg
atcgagatcggcgtgaaggtcggcgacacggtcgagccggagcagtcgctcgtcacgctc
gagtcggacaaggcgacgatggacgtgccgagcccggtaggcggcgtcgtgaaggaaatc
aaggtcaaggtgggcgattccgtgtcggaaggctcgctgatcatcctgctcgaaggcggc
gccgcggcgcaggccaacggcgcggctgcgccggccgcagcaccggctccggcggcagcg
cctgcgccggccgcagcggcaccggttgccgcaccggcagccgccggcggcacgctcgaa
gtgaaggtaccggacatcggcgactacaaggacgtgccggtgatcgagatcggcgtgaag
gtcggcgacacggtcgagaaggaacagtcgctcgtcacgctcgagtcggacaaggcgacg
atggacgtgccgagcccggcagcgggcgtcgtgaaggaaatcaaggtcaaggtgggcgat
tcggtgtcggaaggcacgctgatcgtgctgctcgaagccgcaggtgcagcggctgccgca
ccgcaggcgagcgcaccggcgcccgccgcagcagcgccggcgccgacacccgccgccgca
cccgcgaaggccgcaccggccgctgccgcaccggctccggccgcggcaccgtcgggcgaa
taccgcgccagccacgcatcgccgtcggtacgcaagttcgcgcgcgaactcggcgtcgaa
gtcgcgcgcgtgcagggctcgggtccgaagggccgcatcacgaaggaagacgtcacgggc
ttcgtgaagggcgtgatgaccggccagcgcgcggcaccgggcgcggcagccgcgccggca
ggcggcggcgagctgaatctgctgccgtggccgaaggtcgacttctcgaagttcggcccg
ttcgaggcgaagccgctgtcgcgcatcaagaagatctcgggcgcgaacctgcatcgcaac
tgggtgatgatcccgcacgtcacgaacaacgacgaagcggacatcaccgagctcgaagcg
ctgcgcgtgcagctgaacaaggagcacgaaaaggcgggcgtgaagttcacgatgctcgcg
ttcgtgatcaaggcggtcgtcgccgcgctgaagaaattcccgaccttcaacgcgagcctc
gacggcgacaacctggtgttcaagcagtactaccacatcggttttgccgcggacacgccg
aacggcctcgtcgtgccggtgatccgcgatgcggacaagaaggggctcgtcgatatcgcg
aaggagatggccgagctgtcgaaggccgcacgcgacggcaagctgaagccggaccagatg
cagggcggttgcttctcgatctcgtcgctcggcgggatcggcggcaccaacttcacgccg
atcatcaatgcgccggaagtcgcgatcctcgggttgtcgcgcggtcagatgaagccggtg
tgggacggcaagcagttcgtgccgcgtctgacgctgccgctgtcgctgtcgtatgaccat
cgcgtgatcgatggcgcggaagccgcgcggttcaatgcgtatctcggcgcgttgctcgcg
gatttccgtcgcatcattctttga

DBGET integrated database retrieval system