KEGG   Burkholderia cepacia ATCC 25416: APZ15_18450Help
Entry
APZ15_18450       CDS       T04772                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00440  Phosphonate and phosphinate metabolism
bcep01100  Metabolic pathways
bcep01120  Microbial metabolism in diverse environments
bcep01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    APZ15_18450
Enzymes [BR:bcep01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     APZ15_18450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ALK19868
LinkDB All DBs
Position
2:226483..228168
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVATGTPHGRWIGLLNVR
GAGVERLKAMLATLQARDDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcgcgcagcgcccgcctgcgccgcatgctc
gtcagcagcgacctcgaattcctgatggaagcgcacaacggcctgtccgcacggatcgtc
cgcgaagccggcttcaagggcatctgggcatcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgaattcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcatcgccggcgtctgtatcgaggac
aagcagttcccgaagaccaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgtgtcgaagcgctgatcgcaggctgggggatggacgaggcactgcgtcgc
gcgaacgcgtacgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcgtcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgtggcatcggtcaacgagatc
ttccgcctgcaggacgccgacgaatactcggcggccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgcggcgatcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcacggcgtgaacgacatcaccgtggtcggcggctaccgc
gccgacgcgatcgacacgtcgggcatcaagctcgtggtcaacgagcgccatgcgcagacg
ggcgaactcgcgtcgctcgcatgtgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctgacggaaaccaaccagagcgtgcgcgatttcgcg
ctgtgctcggcggcggacgatcgcggcctgttcggccagaagacctacctgcaacgcgta
tcgagcgacgtcgccacgggcacgccgcacggccgctggatcggcctgctgaacgtgcgc
ggtgccggtgtcgagcgcctgaaggcgatgctcgcgacgctgcaggcgcgcgacgatttc
gacacgctcgacatcccgtcgctgctcaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggtgtgaacgatctcgaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtccgaaccgggcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system