KEGG   Burkholderia cepacia ATCC 25416: APZ15_18655Help
Entry
APZ15_18655       CDS       T04772                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
bcep  Burkholderia cepacia ATCC 25416
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APZ15_18655
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     APZ15_18655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_binding_3 HI0933_like K_oxygenase Thi4 DAO NAD_binding_8 FAD_oxidored Glutaredoxin FMO-like
Motif
Other DBs
NCBI-ProteinID: ALK19906
LinkDB All DBs
Position
2:273805..275403
Genome map
AA seq 532 aa AA seqDB search
MLDANLKNQLKAYLEKITRPIELVASLDDSAKSQELLALLNEIASLTDRVTVAERRDDAE
RKPSFSIGEPGKPAGIRFAGIPMGHEFTSLVLALLQTGGHPIKLDDDVIEQIRALDGDYA
FETYFSLSCQNCPEVVQALNVMSLINPRIRHVAIDGALFQNEVESRQIMAVPTMFLNGAS
FGQGRSSVKEILAKLDTGASERAAKSLENKPVFDTLIVGGGPAGAAAAIYSARKGIATGV
VAERFGGQVLDTMAIENFVSVQETEGPKFATALEQHVKQYDVDIMDVQRADALIPGDVHQ
IRLANGAVLKAKTIVLATGARWREINVPGEREYRNRGVAYCPHCDGPLFKGKRVAVVGGG
NSGVEAAIDLAGIVKEVTLIEYGAQLRADEVLQRKLRSLPNVTIVTQAQTTELTGDGSKL
NGLVYKDLRSGETQRIDLEGVFVQIGLVPNTEWLKGTVELSKHGEIVVDARGATSVPGVF
AAGDVTTVPFKQIVIAVGEGAKASLGAFDHLIRQDVAPVAAARPQAEEAVAA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacgccaatctcaagaaccaactgaaagcgtacctcgaaaaaatcacgcgcccg
atcgaactcgtcgcctcgctcgacgacagcgcgaaatcgcaggaactgctggcgctgctg
aacgagattgcgtcgctgacggatcgcgtgaccgtagccgaacgccgcgacgacgccgag
cgcaagccgtcgttctcgatcggcgagcccggcaagccggccggcatccgcttcgccggc
atcccgatgggccatgaattcacgtcgctcgtgcttgcgctgctgcagactggcggccac
ccgatcaagctcgacgacgacgtgatcgaacagatccgcgcgctcgacggcgactatgcg
ttcgagacgtacttctcgctgtcgtgccagaactgcccggaagtcgtgcaggcgctgaac
gtgatgtcgctgatcaacccgcgcatccgccacgtcgcaatcgacggcgcgctgttccag
aatgaagtcgagtcgcgccagatcatggccgtgccgacgatgttcctgaacggcgcatcg
ttcggccagggccgcagcagcgtgaaggaaatcctcgcgaagctcgatacgggtgcgagc
gagcgtgccgcgaagtcgctcgagaacaagccggtgttcgatacgctgatcgtcggcggc
ggcccggcaggcgcggccgcggccatctactcggcgcgcaagggcatcgcgacgggcgtc
gtcgccgagcgtttcggcggccaggtgctcgacacgatggcgatcgagaacttcgtgtcg
gtgcaggaaaccgaagggcccaagttcgcgaccgcgctcgagcagcacgtgaagcaatac
gacgtcgacatcatggacgtgcagcgcgccgacgcgctgatcccgggcgacgtgcaccag
atccgcctcgcgaacggcgcggtgctgaaggcgaagacgatcgttctcgccaccggcgcg
cgctggcgcgaaatcaacgtgccgggcgagcgcgaataccgcaatcgcggtgtcgcgtac
tgcccgcactgcgacggcccgctgttcaagggcaagcgcgtcgcggtggtcggcggcggc
aactcgggcgtcgaggccgcgatcgacctcgccggcatcgtgaaggaagtcacgctgatc
gaatacggcgcgcaactgcgcgcggacgaagtgctgcagcgcaagctgcgcagcctgccg
aacgtgacgatcgtcacgcaggcgcagacgaccgaactgaccggcgacggcagcaagctg
aacgggctcgtctacaaggatctgcgctcgggcgaaacgcagcgcatcgatctcgaaggc
gtgttcgtacagatcggcctcgtgccgaacaccgaatggctgaaaggtacggtcgaactg
tcgaagcacggcgagatcgtcgtcgatgcgcgcggcgcgacgtcggtgccgggcgtgttc
gcggccggcgacgtgacgacggtgccgttcaagcagatcgtgatcgcggtgggtgaaggc
gcgaaggcatcgctcggcgcgttcgaccacctgatccggcaggacgttgcaccggttgcc
gccgcgcgaccgcaggccgaggaagcggttgccgcgtaa

DBGET integrated database retrieval system