KEGG   Burkholderia cepacia ATCC 25416: APZ15_19605Help
Entry
APZ15_19605       CDS       T04772                                 

Definition
(GenBank) fumarate reductase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00020  Citrate cycle (TCA cycle)
bcep00190  Oxidative phosphorylation
bcep00650  Butanoate metabolism
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01120  Microbial metabolism in diverse environments
bcep01130  Biosynthesis of antibiotics
bcep01200  Carbon metabolism
Module
bcep_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bcep_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bcep_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    APZ15_19605
   00650 Butanoate metabolism
    APZ15_19605
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    APZ15_19605
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     APZ15_19605
    1.3.5.4  fumarate reductase (quinol)
     APZ15_19605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C DAO Pyr_redox_2 FAD_binding_3 Thi4 HI0933_like Lycopene_cycl GIDA Pyr_redox_3 NAD_binding_8 FAD_oxidored
Motif
Other DBs
NCBI-ProteinID: ALK20079
LinkDB All DBs
Position
2:complement(491341..493116)
Genome map
AA seq 591 aa AA seqDB search
MAAIKTNLPRRKFDVVIVGAGGSGLRAALQLSRAGLSVGVLSKVFPTRSHTVAAQGGIGA
SLGNMSEDNWHFHFYDTIKGSDWLGDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIY
QRPFGGHTANYGEKPVQRACAAADRTGHALLHTLYQQNVEAKTQFFVEWMALDLIRDADG
DVLGVTALEMETGDVYIMEGKTTLFATGGAGRIFAASTNAFINTGDGLGMAARSGIALQD
MEFWQFHPTGVAGAGVLITEGVRGEGGILRNANGERFMERYAPTLKDLAPRDFVSRSMDQ
EIKEGRGVGPNKDHVLLDLSHIGAETIMKRLPSIREIALKFANVDAIKEPIPVVPTIHYQ
MGGIPTNIHGQVVGTSRGHKDPVNGFYAVGECSCVSVHGANRLGTNSLLDLVVFGRAAGN
HIVEHVKNQKEHKPLPADAGEFSLARLAKLDKSTSGEYTQDVANDIRSTMQKHAGVFRTS
ELLKEGVDQMAGLKARVENIHLKDKSKVFNTARVEALELENLIEVARATMVSAEARKESR
GAHAHSDYEHRDDENWLRHTLWYSEGDRLDYKPVQMKPLTVDSVPPKPRTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaatcaaaactaatctcccgcgccgcaagtttgacgtcgtgatcgtcggcgcg
ggcggctccggcttgcgcgcggcgctgcaactgtcgcgcgcgggcctgtcggtcggcgtg
ctgtcgaaggtgttcccgacgcgttcgcacacggtggccgcgcagggcggtatcggtgcg
tcgctcggcaacatgagcgaagacaactggcacttccacttctacgacacgatcaagggc
tccgactggctcggcgaccaggacgcgatcgagttcatgtgccgtgaagcgccgaacgtc
gtgtacgaactcgagcacttcggcatgccgttcgaccgcaacgcggacggcacgatctac
cagcgcccgttcggcggccacaccgcgaactacggcgagaagccggtccagcgcgcatgc
gcggccgccgaccgtaccggtcacgcgctgctgcacacgctgtaccagcagaacgtcgaa
gcgaagacgcagttcttcgtcgaatggatggcgctcgacctgatccgcgacgcggacggc
gacgtgctcggcgtgacggccctcgagatggagacgggcgacgtctacatcatggaaggc
aagacgacgctgttcgcgacgggcggcgcaggccggatcttcgcggcatcgaccaacgcg
ttcatcaataccggcgacggcctcggcatggctgcgcgttcgggcatcgcgctgcaggac
atggagttctggcagttccacccgaccggcgtggccggcgcgggcgtgctgatcaccgaa
ggcgtgcgtggtgaaggcggtatcctgcgcaacgcgaacggcgagcgcttcatggaacgc
tatgcaccgacgctgaaggatctggcgccgcgtgacttcgtgtcgcgttcgatggaccag
gaaatcaaggaaggccgcggcgtgggtccgaacaaggatcacgtgctgctcgacctgtcg
cacatcggcgccgagacgatcatgaagcgtctgccgtcgatccgcgaaatcgcgctgaag
ttcgcgaacgtcgacgcgatcaaggaaccgatcccggtcgtcccgacgatccactaccag
atgggcggcatcccgaccaacatccacggccaggtcgtcggcacgtcgcgcggtcacaag
gatccggtcaacggcttctacgcagtgggcgaatgctcgtgcgtgtccgtgcacggcgcg
aaccgcctcggcacgaactcgctgctggacctcgtggtgttcggccgtgcggccggcaac
cacatcgtcgagcacgtgaagaaccagaaggaacacaagccgctgccggccgatgcaggc
gaattctcgctggcgcgcctggcgaagctggacaagtcgacctcgggcgaatacacgcag
gacgtcgcgaacgacatccgttcgacgatgcagaagcacgcaggcgtgttccgcacgtcg
gagctgctgaaggaaggcgtcgaccagatggccggcctgaaggcgcgcgtggaaaacatc
cacctgaaggacaagtcgaaggtgttcaacaccgcgcgcgtcgaagcgctcgagctggag
aacctgatcgaagtggctcgcgccacgatggtgtcggcggaagcgcgcaaggaaagccgt
ggcgcgcacgcacacagcgactacgaacaccgcgacgacgagaactggctgcgccacacg
ctgtggtacagcgaaggcgatcgcctcgactacaagccggttcaaatgaagccgctgacg
gtcgactccgtgccgccgaagccgcgcacgttctaa

DBGET integrated database retrieval system