KEGG   Burkholderia cepacia ATCC 25416: APZ15_21950Help
Entry
APZ15_21950       CDS       T04772                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00620  Pyruvate metabolism
bcep00710  Carbon fixation in photosynthetic organisms
bcep01100  Metabolic pathways
bcep01120  Microbial metabolism in diverse environments
bcep01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    APZ15_21950
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    APZ15_21950
Enzymes [BR:bcep01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     APZ15_21950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTA_PTB malic Malic_M
Motif
Other DBs
NCBI-ProteinID: ALK22444
LinkDB All DBs
Position
2:complement(1017444..1019744)
Genome map
AA seq 766 aa AA seqDB search
MKQTETQQQAAFDYHEFPTPGKISVVASKPLVTQRDLALAYTPGVAGVCEAIAADPLQAH
RFTSRGNLVGVITNGTAVLGLGNIGPLASKPVMEGKAVLFKKFAGIDVFDIEINETDPDK
LVDIIAGLEPTFGGINLEDIKAPECFTVEQKLRERMKIPVFHDDQHGTAITVSAAFINGL
KVVGKSISEVKVVTSGAGAAALACLDLLVDLGLPVENVWVTDIEGVVYRGRTALMDPAKS
RFAQETDARKLADVIGGADVFLGLSVGGILSAEMLKEMAPRPLILALANPTPEIFPELAH
ATRDDVVIATGRSDYPNQVNNVLCFPYIFRGALDVGATTITREMEIAAVHAIAGLAEEEQ
NEVVAAAYGAYDVAFGAQYLIPKPFDPRLIVRIAPAVAKAAMEGGVAKRPLTDLDAYVEQ
LQQFVYHSGAFMKPLFATARRLVRDGGKARIVFTEGEDERVLRAVQVIVDEKLARPILVG
RPEVLLARIERFGLRIRLGQDVEVTNPEYDERFPQYWTTYWELRCRDGISKEMARVEMRR
RLTLIGAMMVRLGDADGMICGTVGEYHNHLRFVDEVIGRKPGASTYAAMNILLLDQRTVA
LVDTHVNDNPDAEQIAEFTIAAARQMEWLNLTPKAALLSRSNFGSGSAASGVKMRRALEI
IREQAPDIEADGEMHGDCALDEGLRSRLLPMSPLKGAANLLVCPNVDAGNIAYNLLKTEA
GSNVAVGPFLLGVNAPVNILTSSATVRRIVNMTALTVIEANRNASV
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagactgagacacagcagcaggcagcgttcgactatcacgaatttccgaccccg
ggaaagatctcggtcgtcgccagcaagccgctcgtgacgcagcgcgatctcgcgctggcg
tacacgccgggcgtggcgggtgtgtgcgaggccatcgccgccgatccgctgcaggcgcac
cgcttcaccagccgcggcaacctggtcggcgtgatcacgaacggcacggccgtgctgggt
ctcggcaacatcggcccgctcgcgtccaagccggtcatggaaggcaaggccgtgctcttc
aagaagttcgcggggatcgacgtcttcgacatcgagatcaacgaaaccgatccggacaag
ctggtcgacatcatcgcgggcctcgagcccaccttcggcggcatcaacctcgaggacatc
aaggcgcccgaatgcttcacggtcgagcagaagctgcgcgaacgcatgaagatcccggtc
ttccatgacgatcagcacggcaccgccatcaccgtgtccgccgcgttcatcaacgggctg
aaggtcgtcgggaagtcgatttccgaagtgaaggtcgtgacgtcgggcgcaggggccgcc
gcgctggcctgcctggacctgctggtcgacctcgggctgccggtcgaaaacgtctgggta
accgatatcgaaggcgtcgtctatcgcgggcgcaccgcgctgatggacccggcgaagtcg
cgctttgcgcaggaaaccgatgcgcgcaagctggccgacgtcatcggcggcgcggacgtg
ttcctgggcctgtcggtcggcggcatcctgagtgccgagatgctgaaggagatggcgccg
cgcccgctgattctggcgctggccaatcccacgccggaaatcttcccggaactggcgcac
gcgacgcgcgacgacgtcgtcatcgcgacggggcgctcggactacccgaaccaggtcaac
aacgtcctctgtttcccgtacatcttccgcggcgcgctggacgtgggcgcgacgacgatc
acccgcgaaatggagatcgccgcggtgcacgcgatcgcggggctggccgaggaggagcag
aacgaagtcgtcgcggcggcttatggcgcgtacgacgtggcgttcggcgcgcaatacctg
attccgaagccgttcgacccgcgcctgatcgtccgtatcgcgccggccgtggcgaaggcg
gcgatggaaggcggcgtggcgaagcgcccgctgacggatctcgacgcgtatgtcgagcaa
ctgcagcaattcgtctaccactccggcgcgttcatgaagccgctgttcgcgacggcgcgc
cggttggtgcgtgacggcggcaaggcacggatcgtcttcaccgaaggtgaggacgaacgc
gtgctccgcgcggtgcaggtgatcgtcgacgagaagctggcgcgtccgatcctggtcggg
cgcccggaagtgctgctggcgcgcatcgagcggttcggcttgcggatccggctcggccag
gatgtcgaggtgacgaaccccgagtacgacgagcggttcccgcagtactggacgacgtat
tgggagctgcgctgccgggacggcatctcgaaggaaatggcgcgggtcgagatgcggcgc
cgcctgacgctgatcggcgcgatgatggtgcggctcggcgatgcggacgggatgatttgc
ggcacggtcggcgaatatcacaaccacctgcggttcgtcgacgaggtgatcggcaggaag
ccgggtgcgtccacgtacgcggcgatgaacatcctgttgctcgatcagcggacggtcgcg
ctggtggacacgcacgtcaacgacaatcccgatgccgaacagatcgcggaattcacgatt
gccgcggctcgtcagatggaatggctgaacctcacgccgaaggcggcgttgctgtcgcgg
tcgaacttcgggtcggggagtgcggcgtcgggcgtgaagatgcgccgggcgctggagatc
atccgggagcaggcgcccgatatcgaggcggacggcgagatgcatggcgactgtgcgctc
gacgagggcttgcggtcgaggctgctgccgatgtcgccgctgaagggggcggcgaacctg
ctcgtgtgcccgaacgtggatgcggggaatatcgcttacaacctgctcaagacggaggcg
ggcagcaatgtggcggtgggaccgttcctgttgggcgtcaacgcgccggtgaatattctg
acgtccagtgcgacggtgcggcggatcgtgaacatgacggcgttgacggtgatcgaggcg
aaccggaacgcgtctgtttga

DBGET integrated database retrieval system