KEGG   Burkholderia cepacia ATCC 25416: APZ15_23360Help
Entry
APZ15_23360       CDS       T04772                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00250  Alanine, aspartate and glutamate metabolism
bcep00410  beta-Alanine metabolism
bcep00640  Propanoate metabolism
bcep00650  Butanoate metabolism
bcep01100  Metabolic pathways
bcep01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    APZ15_23360
   00650 Butanoate metabolism
    APZ15_23360
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    APZ15_23360
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    APZ15_23360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bcep01007]
    APZ15_23360
Enzymes [BR:bcep01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     APZ15_23360
Amino acid related enzymes [BR:bcep01007]
 Aminotransferase (transaminase)
  Class III
   APZ15_23360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ALK22467
UniProt: A0A088TU14
LinkDB All DBs
Position
2:1344892..1346175
Genome map
AA seq 427 aa AA seqDB search
MKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRHPK
IVKAIADQLNNFTHTAYQIVPYASYVELAEKINARAPGDFPKKTAFFTTGAEAVENAIKI
ARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVTTA
DSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIADEV
QTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADLMDAAAPGGLGGTYAGN
PLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEFLK
PGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTITQVVFDEALVILEEVLK
ETVGVPA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtcggcgtg
atgtgcgatttctacgcagcccgcgccgagaacgcggaactgtgggatgtcgaaggccgc
cgcttcatcgatttcgccgccggcatcgcggtgctgaacaccggccaccgccacccgaag
atcgtcaaggcgatcgcggatcaactgaacaacttcacgcacaccgcttaccagatcgtc
ccgtacgcgtcgtacgtcgaactggccgagaagatcaacgcacgcgcgccgggcgatttc
ccgaagaagaccgcgttcttcacgaccggcgcggaagccgtcgagaacgcgatcaagatc
gcacgcgcggccaccggccgtccgggcgtcatcgccttctcgggcggtttccacggccgc
acgatgatgggcatggcgctgaccggcaaggtcgccccgtacaagctgaacttcggcccg
ttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacgacggcc
gactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgcgtcgcc
gcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggccgaattc
gtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgacgaagtg
cagaccggcttcgcgcgtaccggcaagctgttcgcgatgcagcactacgacgtgctggcc
gacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcaggcgtcgtcggc
cgtgccgacctgatggacgcggcagcgcccggcggcctcggcggcacgtatgcgggcaac
ccgctggccgtggcatcggcgcacgccgtgctcgagatcatcgacgaagagaagctgtgc
gagcgcgcgacgcaactcggcgacgtgctgaaggcgaagctgaacgcgctgcaggccgac
gtgccgcagatcgccgacgtgcgcggcccgggcgcgatgatcgcggtcgagttcctgaag
ccgggttcgggcgagccggatgccgagttcacgaagcgcgtgcagacgcgtgcgctcgag
cgcggcctgctgctgctcgtatgcggcgtgtactcgaacgtcgtgcgcttcctgttcccg
ctgacgatcacgcaggtcgtgttcgacgaagcgctcgtgatcctcgaggaagtgctgaag
gaaacggtcggcgtgcccgcctga

DBGET integrated database retrieval system