KEGG   Burkholderia cepacia ATCC 25416: APZ15_24390Help
Entry
APZ15_24390       CDS       T04772                                 

Definition
(GenBank) phospho-2-dehydro-3-deoxyheptonate aldolase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
bcep01130  Biosynthesis of antibiotics
bcep01230  Biosynthesis of amino acids
bcep02024  Quorum sensing
Module
bcep_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    APZ15_24390
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    APZ15_24390
Enzymes [BR:bcep01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     APZ15_24390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ALK20939
LinkDB All DBs
Position
2:complement(1570895..1572025)
Genome map
AA seq 376 aa AA seqDB search
MQNLDNPSHDREVGSADATQDTTRIDDVRIGAVRPLISPALLLDELPVPAATQTLVEDTR
RAIGDILHGRDDRLLLVVGPCSIHDHDQALDYARRLKAAADALKDDLLITMRVYFEKPRT
TVGWKGYINDPRLDGSFRINEGLRAARQLLLDINALGLPASTEFLDLLSPQYIADLIAWG
AIGARTTESQSHRQLASGLSCPIGFKNGTDGGVQVASDAIVAAAASHAFMGMTKMGMAAI
FETRGNDDAHVILRGGKNGPNYDAAHVDACCAVLRKAGLREQVMVDCSHANSNKSHDRQI
DVAQDLARQLSQGEHRIVGVMVESHLEAGRQDLKPGVPLKYGVSITDACLSWTQTEPVLD
VLAEAVRHRRVYSRNA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcagaacctcgacaatccttcccacgatcgcgaggtaggcagcgccgacgcgacgcag
gacaccacgcgcatcgacgacgtccgcatcggcgccgtgcgcccgctgatttcgcccgcg
ctgctgctggacgagctgccggtgccggctgccacgcagacgctcgtcgaggatacgcgc
cgcgcgatcggcgacatcctgcacggccgcgacgaccggctgctgctcgtcgtcggcccg
tgttcgatccacgatcacgaccaggcgctcgactacgcacgccggctgaaggccgccgcc
gatgcgctgaaggacgacctgctgatcacgatgcgcgtctacttcgagaagccgcgcacg
acggtcggctggaagggctacatcaacgacccgcgcctcgacggcagcttccgcatcaac
gaagggctgcgcgccgcgcggcaattgctgctcgacatcaacgcgctgggcctgccggcg
tcgaccgaattcctcgacctgctgagcccgcagtacatcgccgacctgatcgcatggggc
gcgatcggcgcgcgcacgaccgagagccagagccaccgccagctcgcgtcgggcctgagc
tgcccgatcgggttcaagaacggtaccgacggcggcgtgcaggtcgcgtccgacgcgatc
gtcgcggcggccgcgagccatgcgttcatggggatgacgaagatggggatggccgcgatc
ttcgagacgcgcggcaacgacgacgcgcacgtgatcctgcgcggcggcaagaacggcccg
aactacgacgccgcgcatgtcgacgcatgttgtgcggtgctgcgcaaggccgggttgcgc
gagcaggtgatggtcgactgctcgcacgcgaactcgaacaagtcgcacgaccgccagatc
gacgtcgcgcaggatctcgctcggcaactgtcgcagggcgagcaccgaatcgtcggcgtg
atggtcgagagccatctcgaggcagggcggcaggacctgaagccgggcgtgccgctcaag
tacggcgtatcgatcacggatgcgtgcctgagctggacgcagacggagccggtgctcgac
gtgctggcggaggcggtgcgacatcgaagggtgtattcgcgcaatgcgtga

DBGET integrated database retrieval system