KEGG   Burkholderia cepacia ATCC 25416: APZ15_25315Help
Entry
APZ15_25315       CDS       T04772                                 

Definition
(GenBank) 2-deoxy-D-gluconate 3-dehydrogenase
Organism
bcep  Burkholderia cepacia ATCC 25416
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Epimerase Glyco_trans_4_4 KR RmlD_sub_bind Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ALK21103
LinkDB All DBs
Position
2:complement(1791341..1792063)
Genome map
AA seq 240 aa AA seqDB search
MSRQWLFEGRTVAVTGGTSGIGASTAWRFAEAGASVVALGLDATGPHAPVHPRVRCMELD
VTDSDALTRTIAALPRLDVLVNGVGISRHADEYRMDQFELVLNVNLTSVMRASDAALPAL
SVQGGSIVNVASMYTYFGSKDRPAYSASKGGIAQLTRSLAQAWADRGIRVNAVAPGWIDT
PLSSGLMADTQASRRILERTPLGRWGTANEVADVILFLCSPAASFVTGAVVPVDGGYSTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgccagtggttatttgagggaaggaccgtcgcggtaaccggcggtacatcgggc
atcggcgcaagcacggcgtggcgtttcgcggaagccggcgcatcggtcgttgcgctcggg
ctcgacgctaccggcccgcacgcgccggtgcatccgcgcgtccggtgcatggaactggac
gtgacagacagcgacgcactgacgcgcacgatcgccgctttgccgcggctcgacgtgctc
gtcaacggcgtcggcatcagccggcacgccgacgaataccggatggaccagttcgaactc
gtgctgaacgtgaacctgacgtcggtgatgcgcgcctccgacgccgcgttgccggcgttg
tccgtacaaggcggcagtatcgtcaacgtcgcatcgatgtatacgtacttcggcagcaag
gaccgccccgcgtacagcgcgagcaagggcggcatcgcgcagctcacgcgctcgctcgcg
caggcgtgggccgatcgcggcatccgcgtgaacgcggtcgcgcccggctggatcgacacg
ccgctcagcagcggcctgatggccgacacgcaggcgtcacgacgcatcctcgaacgcacg
ccgctcgggcgctggggcacggccaacgaagtcgcggacgtgatcctgttcctgtgctcg
cccgccgcgtcgttcgtgacaggtgcggtcgtgccggtcgacggcgggtattcgacggtc
tag

DBGET integrated database retrieval system