KEGG   Burkholderia cepacia ATCC 25416: APZ15_25325Help
Entry
APZ15_25325       CDS       T04772                                 

Definition
(GenBank) MFS transporter
Organism
bcep  Burkholderia cepacia ATCC 25416
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr LacY_symp MFS_1_like
Motif
Other DBs
NCBI-ProteinID: ALK21105
LinkDB All DBs
Position
2:complement(1793164..1794468)
Genome map
AA seq 434 aa AA seqDB search
MTSPSSSRPAWTYENRLLLILFMTFGFVFFDRLALSFLFPFMSAELHLTNAQLGMVSSAL
ALTWALSGAATGAWSDARGTRKPLLIAAVIGFSVCSALSGLVGGFASLIAFRALMGIAEG
PVLPLSQSLMVESSTPSRRGLNMGLLQGSAAGLLGAMIGPPVVIGIATAHGWRHAFFVSC
IPGFLIAFCIWRWVREVPPGGARHAQADTVGAPAAGGAAISRWALLKERNILLCVLISCF
FLTWFIVIISFAPVFLVDSRHLSPADMGVVMTCLGAAWVFWGFAVPAISDRIGRKPTMIV
FALVAAACPVAMIHANSLWALCALVLATYTGLGCFTLFMATIPAETVPPRAIASALGLIM
GAGELIGGFVAPTVAGFAADKYGLQFAMWTSATGAILACVLSFGLVETAPAVLRKRALAG
TAANRLDTQNLGGR
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccttcctcctccaggcccgcctggacgtacgagaacaggctgctgctgatc
ctgttcatgacgttcggcttcgtgttcttcgaccgcctcgcgctgtcgttcctgttcccg
ttcatgtccgccgagctgcacctgacgaatgcgcagctcggcatggtgtcgtccgcgctc
gcgctcacgtgggcgctgtcgggcgccgcgaccggcgcgtggtccgacgcgcgcggcacg
cgcaagccgctgctgatcgccgccgtgatcggcttttccgtgtgctcggcactgtcgggg
ctcgtcggcggtttcgcgagcctgatcgcgttccgcgcgctgatgggcatcgccgaaggc
ccggtgctgccgctctcgcagtcgctgatggtcgagagttcgacgccgagccgccgcggg
ctgaacatgggcctgctgcaaggctccgccgccggcctgctcggcgcgatgatcggcccg
ccggtcgtgatcggcatcgcgaccgcgcacggctggcgccacgcgttcttcgtatcgtgc
attcccggcttcctgatcgcgttctgcatctggcgctgggtgcgcgaggtgccgcccggc
ggcgcacggcatgcgcaggccgacaccgtcggcgcaccggccgcgggcggcgcggcgatc
agccgctgggcgctgctgaaggaacgcaacatcctgctttgcgtgctgatcagctgcttc
ttcctcacgtggttcatcgtgatcatctcgttcgcgccggtgttcctcgtcgacagccgc
cacctgtcccctgccgacatgggcgtcgtgatgacctgcctcggcgccgcgtgggtgttc
tggggtttcgcggtgcccgcgatctccgaccggatcggccgcaagccgacgatgatcgtg
ttcgcgctggtcgccgccgcgtgccccgtcgcgatgattcacgcgaattcgctgtgggcg
ctctgcgcgctcgtgctcgcgacctacacgggcctcggctgtttcacgctgttcatggcg
acgatcccggcggaaacggtgccgccgcgcgcgatcgccagcgcgctcgggctgatcatg
ggcgccggcgagctgattggcggcttcgtcgcgccgaccgtcgccggcttcgccgcggac
aagtacggcctgcagttcgcgatgtggacgtcggccaccggcgcgatcctcgcgtgcgtg
ctgtcgttcggcctcgtcgaaaccgcgcccgccgtgctgcgcaagcgcgcgctcgccggc
acggccgcgaaccgtctcgatacacagaacctcggaggacgctga

DBGET integrated database retrieval system