KEGG   Burkholderia cepacia ATCC 25416: APZ15_32405
Entry
APZ15_32405       CDS       T04772                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K18287  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase [EC:4.1.2.56]
Organism
bcep  Burkholderia cepacia ATCC 25416
Pathway
bcep00997  Biosynthesis of various secondary metabolites - part 3
bcep01100  Metabolic pathways
bcep01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bcep00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00997 Biosynthesis of various secondary metabolites - part 3
    APZ15_32405
Enzymes [BR:bcep01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.56  2-amino-4,5-dihydroxy-6-oxo-7-(phosphooxy)heptanoate synthase
     APZ15_32405
SSDB
Motif
Pfam: DeoC
Other DBs
NCBI-ProteinID: ALK22630
LinkDB
Position
3:complement(1824..2585)
AA seq 253 aa
MRRVVRAASGKCLMVPLDHSLADGPIAHPQQLRQLVGDIAAHGGDAIVVHRGRARFLAPD
VLSDLALVVHLNGCTRYAEDANAKTLFASVEDALASGADAVSVHVNLGSKTESQQLLDLS
RIATECARWSLPLLAMIYPRGPGLGDRPQAELIAHAANVAADLGADIVKLPYSGDAASMA
DIIAGSSLPVLVAGGAKLPEDEFVAFTSRVMNAGALGIAAGRNVFAAPKAAPLIRRLSDA
VHGVERRAAHLAA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgcggcgggtggtgcgtgccgcgtcgggcaagtgtctgatggtgccgctcgatcattcg
ctcgcggacgggccgatcgcccatccgcagcagttgcggcaactggttggcgacatcgcc
gcgcacggcggcgacgcgatcgtcgtgcatcggggccgcgcgcgcttcctggcgcccgac
gtgctgagcgatctcgcgctcgtcgtgcacctgaacggttgcacgcgctacgcggaggac
gcgaacgcgaagacgctgttcgcgagcgtcgaggacgcgctggcgagcggcgcggacgcg
gtcagcgtgcacgtgaatctcggctcgaaaacggaatcccagcagctgctcgacctgagc
cgcatcgcgaccgaatgcgcgcgctggtcgctgccgctgctcgcgatgatctatccgcgc
ggccccggcctcggcgatcgtccgcaggccgaactgatcgcccatgcggcgaacgtcgcg
gcggatctcggcgccgacatcgtcaagctgccgtacagcggcgacgccgcgagcatggcc
gacatcatcgccggttcgtcgctgccggtgctggtcgcgggcggcgcgaagctgcccgaa
gacgagttcgtcgcgttcacgtcgcgggtgatgaacgcgggcgcgctcggcatcgcggcc
ggccgcaacgtgttcgccgcgccgaaggccgccccgctgatccgccgcctgtcggacgcg
gtgcacggcgtcgagcggcgcgccgcgcacctggccgcctga

DBGET integrated database retrieval system