KEGG   Bacillus cereus FRI-35: BCK_01735Help
Entry
BCK_01735         CDS       T02291                                 

Definition
(GenBank) internalin
  KO
K13730  internalin A
Organism
bcer  Bacillus cereus FRI-35
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLH LRR_4 NEAT LRR_8 LRR_9 NosD LRR_adjacent
Motif
Other DBs
NCBI-ProteinID: AFQ08257
LinkDB All DBs
Position
complement(298854..301136)
Genome map
AA seq 760 aa AA seqDB search
MKKNYMKALVVATTLAIPFAAYSTPALAAIKIEANQSVAAASERTYDTEIKIYKDQKDEP
SMVSQYIKDPKVTIADGKKIVTITMQDSDYFQYLRIEDKNQPGVFHDVKVLSEDKRKNGT
KVVQFEIGEFEKKHNIQMHILIPAIGYDHKYQVQFEIKDPTVGDKETEKPDDKSNSGNTE
TDHPVDNQNMITDNKLRELVNKKVFNRKDLNTPITKEELLQVKDLFLNTNEILDYSALKY
MPNLKSLTVANAKIKDPSFFTSLKQLKHLALRGNEFSDVTPIVKMDNLDSLDLSNNKITN
VAPLIEMKNVKSLYLSGNQIEDVTALAKMEQLDYLNLANNKITNVAPLSALKNVTYLTLA
GNQIEDIKPLYSLPLKDLVLTRNKVKDLSGIEQMKQLEELWIGKNEIKDVTPLSKMTQLK
QLHLPNNELKDITPLSSLVNLQKLDLEANYISDLTPASNLKKLVFLSFVANEIRDVRPVI
ELSKTAYINVQNQKVFLEETEVNKEVKVPIYEKDGKISTKIRLKSEGGTYSNDAVKWSTP
GEKVYEFGVKDPFADTGIFFTGSVIQNVVESKEDNNSKEDEKVEVVEFKDVPKGHWSEEA
IHYLAKENIFKGYGNGQFGFGDRITRGQVASLVQRYLKLENKVEQKERFTDTKGHMFEQD
IATVAQAGIMQGDGTGEFRPDGVLTRYEMSVVLYKVFQLKEDENNKVNFNDVPTGHWAEE
YVKALADNNISKGDGKGNFLGDDFVTREQYAQFLYNAMTK
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaaaattatatgaaggcgctagtagtagcgacaacattagcaattccatttgct
gcatactctactccagcgttagcagcaataaaaattgaagcaaaccaatcggtagcggca
gctagtgaacgtacatacgatactgagattaaaatatataaggatcaaaaagatgagcca
tctatggtttctcaatatataaaagatcctaaagtaacgattgcggacgggaaaaaaatt
gtaactataacaatgcaagatagcgattattttcaataccttagaatagaggataaaaac
caacctggcgtatttcatgatgtaaaagttttgtcagaagataagaggaagaatggaacg
aaagtagttcaatttgaaattggcgagtttgagaagaagcacaatatacaaatgcatata
cttattccggctattggatatgatcacaaatatcaagttcaatttgaaattaaagatcca
actgtaggtgacaaagaaacagagaaaccagatgataaatctaattccggcaatacggag
acggatcatccagttgataatcaaaatatgataacagataataaattaagagaacttgtt
aataaaaaggtatttaatagaaaagatttaaatacaccaatcacgaaagaagagttatta
caagtaaaggatttgtttttaaatacgaatgagatactggattatagtgcattaaaatat
atgccaaatttaaaatctttaacagttgcgaatgcgaagataaaagatccatcattcttt
acgagcttaaaacaattgaaacatttagctttacgtggtaatgaattttcagatgtaaca
ccaattgttaagatggataatttagattctcttgatttaagtaataataaaattacgaac
gttgcaccactaattgaaatgaaaaatgtaaaaagtttatatttatcaggcaaccaaata
gaagatgtaacagcattagcgaaaatggaacaactagattacttgaatttagcaaataat
aaaattacgaatgttgcgccattaagcgcgttgaaaaatgtaacatacttaactttagca
ggtaatcaaattgaagatattaaaccgttatattcattacctttaaaagacttagtatta
acacgtaataaagtaaaagacttatccggtattgagcaaatgaagcaattagaagaattg
tggatcgggaaaaatgaaataaaagatgttactcctctaagtaagatgacacagttaaaa
caattacacttacctaacaatgagttaaaggatattactccattatcaagtctagtaaac
ttacaaaagcttgatttagaagcgaattatatttcagacttaacaccagctagcaatttg
aaaaagttagtattcttaagttttgttgcaaatgaaattcgtgatgttcgaccagttata
gaactaagtaaaacagcctatatcaatgttcaaaatcaaaaagtatttttagaggaaaca
gaagtaaataaagaagtaaaagtacctatatacgagaaagatggtaaaatctctacaaaa
attcgtttaaagagcgaaggtggtacgtatagtaatgatgcagttaagtggagtacacca
ggtgagaaagtatatgaatttggtgtaaaagatccatttgcggatacaggaatcttcttc
acaggatctgtgattcaaaatgtggtagaaagtaaagaagacaataattctaaagaagat
gaaaaagtagaagtagtagaatttaaagatgtaccaaaaggacattggtcagaggaagca
attcattatttagcgaaagaaaatattttcaagggatatggaaatggacaatttggattt
ggggatcgtattactcgtggacaagttgcgtctttagtacaaaggtatttgaaattagaa
aataaagtagagcagaaagagagatttacagatacgaaaggacatatgtttgagcaagat
attgctacagttgcgcaagctggaattatgcaaggagatggtactggggagtttcgtcca
gatggagtattaactcgatacgaaatgtctgtagtattatataaagtatttcagctaaaa
gaagatgaaaataataaagtgaactttaatgatgtaccaactggtcattgggcagaagaa
tatgtgaaagcgttagcggacaataacatatcaaaaggtgatggaaaaggaaacttttta
ggtgatgattttgtaacacgtgaacaatatgcacagttcttatataacgcaatgacgaaa
taa

DBGET integrated database retrieval system