KEGG   Bacillus cereus FRI-35: BCK_06370Help
Entry
BCK_06370         CDS       T02291                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
bcer  Bacillus cereus FRI-35
Brite
KEGG Orthology (KO) [BR:bcer00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BCK_06370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AFQ09181
LinkDB All DBs
Position
complement(1247935..1248705)
Genome map
AA seq 256 aa AA seqDB search
MDELSFQVIILLIAFGFLAAFIDSVVGGGGLISLPALMFVGLPPASAIATNKLAATMGTF
TSAIYFIRSGKVDFKIVGKLIPLTIIGAVAGALVVKFIPPDILRPLVLVMLVFIAIYIIA
KKDWGSVSTYKKMTKRKTLIFFFVILMIGFYDGFFGPGTGSFLIFAFLLIGLDFIQAAAS
GKLLNFVSNIVSLITFLFLDVIHFEYGIIMGLSMILGAYFGSKFAVQKGVGYVRTLFLLV
TILLISKNVLEYTHIL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattaagttttcaagtcattattttattaattgcattcggttttttagcagct
tttattgattcagttgttggtggtggaggattaatttcgcttccggcacttatgtttgtt
ggtttaccaccagcttcggcaattgcaacgaataaattagctgcaacgatggggacgttt
acgagtgcgatttactttattcgatcgggaaaggttgattttaaaattgtaggaaagtta
atcccgttaactattataggggcagtcgcaggtgctttagtagtaaagtttattccgccg
gatattttacgtccgttagtgcttgtgatgttggtgtttattgccatttatattattgcg
aaaaaggattggggaagtgtatctacctataagaagatgacgaaaagaaaaacattaata
tttttctttgttattttaatgatagggttttacgatgggttttttggaccagggacagga
tccttcttaatttttgcatttttattaattggtttggattttattcaagcagcagcatct
ggaaaacttttgaactttgttagtaatatcgtatcgttaatcacttttttatttttagac
gtaattcattttgaatacggtattattatgggattatcgatgattttgggcgcttatttt
ggatcgaaatttgcagttcaaaaaggtgttggatatgtaagaactttattcttgttagta
actattttattgattagcaaaaacgttttggaatatactcatattttgtag

DBGET integrated database retrieval system