KEGG   Bacillus cereus FRI-35: BCK_20380Help
Entry
BCK_20380         CDS       T02291                                 

Definition
(GenBank) (3R)-hydroxymyristoyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00061  Fatty acid biosynthesis
bcer00780  Biotin metabolism
bcer01100  Metabolic pathways
bcer01212  Fatty acid metabolism
Module
bcer_M00083  Fatty acid biosynthesis, elongation
bcer_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:bcer00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    BCK_20380
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    BCK_20380
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bcer01004]
    BCK_20380
Enzymes [BR:bcer01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     BCK_20380
Lipid biosynthesis proteins [BR:bcer01004]
 Fatty acid synthase
  Component type
   BCK_20380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA AfsA
Motif
Other DBs
NCBI-ProteinID: AFQ11963
LinkDB All DBs
Position
complement(3994023..3994421)
Genome map
AA seq 132 aa AA seqDB search
MYIKDTLPHRYPFLMIDKVTNVKQDESVTGYKLITNNEWFINDSQKHMPHMLIVEALAQL
SAFVHTSDSEGLGFLSSLDGVAFHEKAYPGDKLDLHYELIRNRRGFVLGKGIATVNDQPI
VTIEKLLIYQTD
NT seq 399 nt NT seq  +upstreamnt  +downstreamnt
atgtatattaaagacactcttcctcatcgttatccttttttaatgattgataaagtaaca
aatgtaaaacaagatgaatctgttacaggatataaactcattacaaataacgaatggttt
ataaatgatagtcaaaaacatatgcctcatatgttaattgtagaagcacttgctcagctt
agcgcatttgtacatacaagtgattctgaaggactcggtttcctctcctcgttagatggg
gttgcgttccatgaaaaagcatatcccggcgataaacttgatttacattatgagctaatt
cgtaatcgccgaggttttgttctaggtaaaggcatcgcaacagtaaacgatcagcctatt
gtaactatagaaaagctattaatatatcaaacagattaa

DBGET integrated database retrieval system