KEGG   Bacillus cereus FRI-35: BCK_24190Help
Entry
BCK_24190         CDS       T02291                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcer  Bacillus cereus FRI-35
Pathway
bcer00473  D-Alanine metabolism
bcer01100  Metabolic pathways
bcer01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcer00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCK_24190
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    BCK_24190
Enzymes [BR:bcer01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCK_24190
Peptidoglycan biosynthesis and degradation proteins [BR:bcer01011]
 Precursor biosynthesis
  Racemase
   BCK_24190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4170
Motif
Other DBs
NCBI-ProteinID: AFQ12714
LinkDB All DBs
Position
complement(4734584..4735759)
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNAAKELGIHIPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSKEVDH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAIVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgagtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatggatatggtcatggggcagttgaagttgcgaaagctgctattgaagctgga
ataaatcagcttgcagttgcgtttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacgtcagtagcagctgcggaagaagcaattcaa
tatgacgttatgatgactgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaagtgaaaattgatacagggatgagtcgtatc
ggtttacaagaagaagaggttaaaccatttttagaagaattaaaacgtatggagtatgtg
gaggtagtaggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatgcagcaaaagaattagggattcat
attccatatattcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaa
aatatggttcgtgtaggtattgggatttatggaatgtatccttcaaaagaggtagatcat
tcagttgtttctctgcagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccactgtaccgattggttatgctgatggctataaccgtcagttatctaataaaggg
tatgcattaataaatggagttcgagtacctgttattggtcgtgtttgtatggatcagctt
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagacagaagaattccacgtgtatataaagaaaataatgaa
acgactgctattgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system