KEGG   Brucella ceti TE10759-12: V910_100599Help
Entry
V910_100599       CDS       T02934                                 

Definition
(GenBank) Bcr/CflA subfamily drug resistance transporter
  KO
K07552  MFS transporter, DHA1 family, multidrug resistance protein
Organism
bcet  Brucella ceti TE10759-12
Brite
KEGG Orthology (KO) [BR:bcet00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcet02000]
    V910_100599
Transporters [BR:bcet02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    V910_100599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr Sugarporin_N
Motif
Other DBs
NCBI-ProteinID: AHA99172
LinkDB All DBs
Position
1:630459..631619
Genome map
AA seq 386 aa AA seqDB search
MGEPKSARAPHETLMKARLPWLPVLCAMPLFLAFFLALALAQLFCGPLSDMVGRKLPLYG
GLVLFAIGSIGSALAANIDVLVLFRFVQGLGAAAGMVIPRAIVRDLHTGVEAARLMSLLM
LVFSISPILAPLTGSIIISFFGWRGVFWAVLLAAGIGIILVATAQKETRSVEARLESNIS
SALRGYGRLLKDRHFLGLVFVGGFGLASLFVYLANSAFVLIDHYGLTPIQYAVAFSANAV
SFFGVSQLNGWLGARFGLGRVMRFAACGFAAAMLAMFAAALMGHQSLWLVASFLFVGYGF
LGLVIPATAVLALEEHGEIAGTAFALMGTLHFVIGGVAIGIVGAYSDGTALPMIGGITGC
ALAAFVLAQIVLARKSRKRGRATAAA
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagccgaaatcggcgcgggcacctcacgaaacattgatgaaagcgcgtctccca
tggcttccagtcttgtgcgcaatgccattgttcttggccttctttctggcactggcgctg
gcgcagcttttctgcgggcccctgtccgatatggtcgggcgtaaactgccgctttatggc
gggctggtgctcttcgccataggcagcatcggttcggcgcttgcggccaatatcgacgtg
ctggtgctgttccgtttcgtccagggattgggggctgcggcaggcatggtgataccgcgc
gccatcgtgcgcgatcttcatacgggtgtcgaggccgcgcgccttatgtcgcttttgatg
ctggtcttttcgatttcgccgattctggccccgctgactggctccatcatcataagcttt
ttcggctggcgcggggttttctgggccgtgttgcttgccgccggcatcggcatcatactg
gttgcgaccgcgcagaaggaaacgcgcagcgtcgaggcgcggcttgagagcaatatcagc
agcgcattgcgcggttacgggcggctgttgaaggaccgtcatttcctcggcctcgtcttc
gtgggcggtttcggtcttgcgtccttgttcgtttatctggcgaattccgccttcgtgctg
atcgaccattatggcctgacaccgatacaatatgccgtggcattttccgccaatgccgtg
tcgttcttcggcgtttcgcagctcaacggctggcttggcgcgcgtttcggccttggccgg
gtgatgcgctttgctgcttgcggctttgccgcagcaatgcttgccatgttcgcggcggcg
ctgatggggcatcaatcactctggctggtcgcaagcttcctctttgtcggttacggcttc
cttgggctggttattccagctacggcggtgctggcgctcgaagaacacggcgagattgcc
ggaacggcatttgcattgatgggcacgcttcacttcgtcattggtggcgtggcgattggt
attgtcggagcctattccgatggcacggcgctgccgatgattggcggcatcaccggctgt
gcgctggcggcgttcgtgctggcgcagatcgtccttgcccgcaagtcgagaaagcgcggc
agagcaacggcggcagcctga

DBGET integrated database retrieval system