KEGG   Brucella ceti TE10759-12: V910_100817Help
Entry
V910_100817       CDS       T02934                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K01286  D-alanyl-D-alanine carboxypeptidase [EC:3.4.16.4]
Organism
bcet  Brucella ceti TE10759-12
Brite
KEGG Orthology (KO) [BR:bcet00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    V910_100817
Enzymes [BR:bcet01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     V910_100817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 SPOR Beta-lactamase2 Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AHA99350
LinkDB All DBs
Position
1:complement(836947..838365)
Genome map
AA seq 472 aa AA seqDB search
MRTAFSKVAYALKKAAQVSLLLTAVTGYSTVSSIAPAMAKGDNRYAAIVVDANTGKTLFS
ANADAQRYPASLTKMMTLYMLFEAIHAGRINKDTRIPVSAYAASRPPTKIGFRPGQSIRA
EDAALAMITKSANDVAAAVGEYLGGSEERFAQMMTARARRLGMRNTTFRNASGLPNMAQH
SSARDMAILGMALRRHFPREFAYFSRSSFDFRGQTIRGHNRLLGRVEGVDGIKTGYTNAS
GYNLVSSVNLDGRRLVAVVMGGNTGASRDAHMAQLIRKYLPMAARGRNNDALIAARSEAP
QVVASIDLPKAKRAPVPVARIAVEDIINAEIGEGDIDQPQVLALVAPTPRPAALAAQAAV
LPTPKAPVRPTQAPAQDVDPVTTASASAASGWAIQIGSLPSEGQARDMLAKASATAGRTL
RSASPYTETFNKGSATFYRARFVGFTSKQAAWDACASLKRNNFGCYAVANSN
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtaccgcattcagtaaagtcgcatatgccttgaaaaaagcggcacaggtctctctt
cttctaacagccgtgacgggttactccacggtttcctccattgcaccggccatggcgaaa
ggcgacaacagatatgccgcgatcgtcgttgatgcgaacaccggcaagacgcttttctcg
gcaaatgccgatgcacagcgctatccggcgtcgctgaccaagatgatgacgctctatatg
ctgtttgaagccatccacgccggccgcatcaacaaggatacgcgcattcccgtgtcggcc
tatgccgcctcccgtccgcccacgaagatcggctttcgtcccggccagtcgattcgggcg
gaagatgcggcccttgcgatgattacgaaatccgcaaacgacgttgctgcggcagtcggt
gaatatcttggcggctcggaagaacgtttcgcccagatgatgaccgcaagggcgcgccgc
cttggtatgcgcaacacgaccttccgcaatgcgtccggcctgccgaacatggcccagcat
tcgtccgcccgcgacatggccatccttggcatggcgctgcgtcgccatttcccgcgtgaa
tttgcctatttctcgcgcagcagcttcgatttccgcggccaaaccatccgtggccataac
cggcttcttggccgtgtcgaaggcgtggacggcatcaagacgggctataccaacgcttcc
ggttacaaccttgtttcgtcagtcaatctcgatggtcgccgtctcgtcgccgtcgtgatg
ggcggcaataccggcgcaagccgcgatgcccacatggcccagcttattcgcaaatatctg
ccgatggccgcccgtggccgtaataacgatgctttgattgccgcgcgcagtgaagcccca
caggttgtggcttccatcgacctgccaaaagccaaacgtgcaccggtgcccgtcgcccgc
atcgccgtcgaggacatcatcaatgccgaaatcggtgaaggtgatatcgaccagccgcag
gttctggccctcgtagcccccaccccgcgcccggcggctctggccgctcaggcagccgta
cttccgacgccgaaggcccccgttcggccaacgcaggccccggcacaagatgtggatccg
gtgacaacggcatccgcatcggctgcaagcggctgggcgatccagatcggctcgctcccg
agcgaaggacaggcccgcgatatgctggccaaggcgtccgccactgctggccgcacactg
cgctccgcttcgccctatacggaaaccttcaacaagggtagcgccaccttctatcgcgcc
cgtttcgtcggctttacctccaagcaggcggcctgggatgcttgcgcctcgctgaagcgc
aataacttcggctgctatgcggtagcgaactcgaactga

DBGET integrated database retrieval system