KEGG   Brucella ceti TE10759-12: V910_200369Help
Entry
V910_200369       CDS       T02934                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcet  Brucella ceti TE10759-12
Pathway
bcet00473  D-Alanine metabolism
bcet01100  Metabolic pathways
bcet01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcet00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    V910_200369
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    V910_200369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcet01011]
    V910_200369
Enzymes [BR:bcet01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     V910_200369
Peptidoglycan biosynthesis and degradation proteins [BR:bcet01011]
 Precursor biosynthesis
  Racemase
   V910_200369
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AHB00682
LinkDB All DBs
Position
2:complement(384650..385849)
Genome map
AA seq 399 aa AA seqDB search
MVEMSLPFSQDERDLAAGGILTIDLAALRHNYSAIATRIAPTRTAAVVKADAYGLGASRV
APAFYEAGCRDFFVAHLGEAVALKPFLKPDATLYVLNGLQPGTEAACAREGILPVLNSLE
QVENWAALATRLGKKLPALLQFDTGMSRLGLSAKEFDRLLENVTLLSRIDIKFAISHLAN
GDEPGNAANARQLAKMTALLARLPKLPAALANSGGTFLGKTYYFDLARPGIALYGIDPER
QHDFSDKVAHENKKPKHSILPVLTLSARVIQVRDVDKGATVGYGGTYVANGPMRIATIAV
GYADGLFRSLSNKGAAFFGDTRLPIIGRVSMDSITLDVTSLPEGTLKLGSLVELIGPHQL
LEDVARDCDTIPYEILTALGNRYARVYVYVNGGGTSTTA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggttgagatgtctttacctttttctcaggatgagcgcgatctcgcggctggcggcata
ttgaccattgatctcgcagccctgcgccacaattattcagccatcgcaacccgcattgcc
ccaacccgtacggccgctgtggtaaaggcagacgcctatggcctgggcgcaagccgggtc
gcaccggctttctacgaggccggttgccgcgatttcttcgttgcacatcttggcgaagca
gtggcgctgaagccctttttgaaacccgacgcaacactttatgtcctgaacggccttcag
cccggaacggaagcagcctgtgcccgcgaaggcatcctgcctgttctcaattcgctggaa
caggttgaaaactgggcagcactcgccacccggctgggcaaaaaactgcccgccctgctc
cagttcgataccggcatgtctcgtcttggcctgtcagccaaggaatttgaccgccttctt
gagaacgtcacgctcctgagcaggatcgacatcaaattcgccatcagccatctggcaaac
ggcgacgagccgggaaatgcggcaaatgcccgtcagcttgccaagatgacggccttgctc
gctcgcctgccgaaactgccggctgccttggccaattccggcggcaccttcctcggcaag
acctattatttcgatctcgcccgccccggcatcgcgctatatggcatcgatccggagagg
cagcatgacttttcggataaggtggcgcacgagaataagaaacccaagcattcgatcctt
cccgtcctcaccctttcggcgcgtgtcattcaggtgcgcgacgtcgacaagggagcgaca
gttggctatggcggcacctatgtcgccaacggcccgatgcggattgcgacgattgcggtc
ggctatgctgacggcttgttccgttccttgagtaacaagggcgcagcctttttcggcgat
acgcgcctgcccatcatcgggcgcgtatcgatggattcgatcacgctcgacgtcacctca
ttgccggagggaacgctgaaactcggcagccttgtggaattgatcggcccgcatcagctc
ctcgaagacgtggcgcgggactgcgacactatcccctatgaaattctgactgcgcttggc
aaccgttatgcgcgcgtttacgtttacgtgaatggcggtggcaccagcacaacagcataa

DBGET integrated database retrieval system