KEGG   Brucella ceti TE10759-12: V910_200592Help
Entry
V910_200592       CDS       T02934                                 

Definition
(GenBank) iron complex transport system permease
  KO
K02015  iron complex transport system permease protein
Organism
bcet  Brucella ceti TE10759-12
Brite
KEGG Orthology (KO) [BR:bcet00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bcet02000]
    V910_200592
Transporters [BR:bcet02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter
    V910_200592
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FecCD
Motif
Other DBs
NCBI-ProteinID: AHB00865
LinkDB All DBs
Position
2:complement(625886..626848)
Genome map
AA seq 320 aa AA seqDB search
MKGLAAAVIVVAVLAVISLFIGVSDVSLHTLFGKASTDRATEVLLISRIPRTLAIILAGM
SMAVAGMIMQMLTRNRFVEPSTAGTVESASLGILLVILFAPETPVFGKMLVASVSALAGT
ALFLRILRSIPLRSVLVVPLVGIMLGGVINAITTFIAYRFDLLQSLNSWTTGDFSGVLRG
RYELLWIAFALTVVAYVAADRFTVAGLGEDFTTNLGLNYRRVVTLGLVIVSMVSASVVVT
VGMIPFLGLIVPNVVSMFIGDNMRRAVPWVALLGAGLVLACDIVGRLIRFPYEIPIGTMM
GVVGSAIFLYLLLRRGSRLA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggactagcagcagccgtaattgttgtcgccgtgctggctgtcatcagccttttc
atcggggtcagcgatgtatcgctgcacacgcttttcggcaaggcaagcacagaccgggca
acggaagtcctgctcatcagccgcattccgcgtacgcttgccattattctcgccggcatg
tccatggctgttgcaggcatgattatgcaaatgctgacccgcaaccgtttcgtggagcct
tccacggcgggaaccgtggaatcggcaagcctcggcattctgctggttattctctttgcg
cctgaaacgccggtcttcggcaagatgctggtggcctccgtcagcgccctcgccggcacc
gcccttttcctgcgcatcctgcgttccattccactgcgctcggtgcttgtcgtgccgctc
gtcggcatcatgctcggcggcgtcatcaatgccatcaccaccttcatcgcctatcgcttc
gatctcctgcaatcgctgaattcatggacgacgggcgacttttcaggcgtgctgcgcgga
cgctatgagcttctatggatcgccttcgccctgacggtggtggcctatgtcgccgccgac
cgcttcacggtcgcggggcttggcgaagacttcaccaccaatctcggccttaattatcgc
cgcgtggtcacactcggccttgtcatcgtttccatggtaagcgcctccgtcgtggtgact
gtcggcatgatcccctttctggggttgatcgtacccaatgtggtcagcatgttcatcggt
gacaatatgcgtcgtgccgtgccgtgggtggcgcttctgggtgcggggctggtgcttgcc
tgcgatattgtcgggcggctgatccgctttccctatgaaattcccatcggcacgatgatg
ggcgtggtgggcagcgccatcttcctctacctcctgctaaggcggggatcgcgccttgca
taa

DBGET integrated database retrieval system