KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_1051Help
Entry
DM40_1051         CDS       T03488                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bcew03012]
    DM40_1051 (tuf)
   03029 Mitochondrial biogenesis [BR:bcew03029]
    DM40_1051 (tuf)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bcew04147]
    DM40_1051 (tuf)
Translation factors [BR:bcew03012]
 Eukaryotic Type
  Elongation factors
   DM40_1051 (tuf)
 Prokaryotic Type
   DM40_1051 (tuf)
Mitochondrial biogenesis [BR:bcew03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    DM40_1051 (tuf)
Exosome [BR:bcew04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DM40_1051 (tuf)
  Exosomal proteins of breast cancer cells
   DM40_1051 (tuf)
  Exosomal proteins of colorectal cancer cells
   DM40_1051 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase cobW AAA_23 Lsm_C
Motif
Other DBs
NCBI-ProteinID: AIO40928
UniProt: A0A088UUW5
LinkDB All DBs
Position
1:1151264..1152454
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLTKKFGGEAKAYDQIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDFPGDDTPIVKGSAKLALE
GDTGELGEVAIMNLADALDTYIPTPERAVDGAFLMPVEDVFSISGRGTVVTGRVERGIIK
VGEEIEIVGIKPTVKTTCTGVEMFRKLLDQGQAGDNVGILLRGTKREDVERGQVLAKPGS
ITPHTHFTAEVYVLSKDEGGRHTPFFNNYRPQFYFRTTDVTGSIELPKDKEMVMPGDNVS
ITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagtttgagcggaccaagccgcacgtcaacgttggtacgattggtcac
gttgaccacggcaagacgacgctgacggcagcgatcacgacggttctgacgaagaagttc
ggcggcgaagcgaaggcgtacgaccagatcgacgcggcaccggaagaaaaggcgcgcggc
atcacgatcaacacggcacacgtcgagtacgaaacggcaaaccgccactacgcacacgtc
gactgcccgggccacgctgactatgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtgtgctcggcagcagacggcccgatgccgcaaacgcgtgagcacatc
ctgctggcgcgtcaggttggcgttccgtacatcatcgtgttcctgaacaagtgcgacatg
gtggacgacgctgaactgctcgagctggtcgagatggaagttcgcgagctgctgtcgaag
tacgacttcccgggcgacgacacgccgatcgtgaagggttcggcgaagctggcgctggaa
ggcgacacgggcgagctgggcgaagtggcgatcatgaacctggcagacgcactggacacg
tacatcccgacgccggagcgtgcggttgatggcgcgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggtacggtggtgacgggtcgtgtggagcgcggcatcatcaag
gtcggcgaggaaatcgaaatcgtcggtatcaagccgacggtgaagacgacctgcacgggc
gttgaaatgttccgcaagctgctggaccaaggtcaggcaggcgacaacgtgggtatcctg
ctgcgcggcacgaagcgtgaagacgtggagcgcggccaggttctggcgaagccgggttcg
atcacgccgcacacgcacttcacggcagaagtgtacgtgctgagcaaggacgaaggcggc
cgtcacacgccgttcttcaacaactaccgtccgcagttctacttccgtacgacggacgtg
acgggctcgatcgagctgccgaaggacaaggaaatggtgatgccgggcgacaacgtgtcg
atcacggtgaagctgatcgcgccgatcgcgatggaagaaggtctgcgcttcgcaatccgc
gaaggcggccgtaccgtcggcgcaggcgtcgtcgccaagatcatcgagtaa

DBGET integrated database retrieval system