KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_1434Help
Entry
DM40_1434         CDS       T03488                                 

Definition
(GenBank) glutamate-ammonia ligase adenylyltransferase family protein
  KO
K00982  [glutamine synthetase] adenylyltransferase / [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase [EC:2.7.7.42 2.7.7.89]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DM40_1434
Enzymes [BR:bcew01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.42  [glutamine synthetase] adenylyltransferase
     DM40_1434
    2.7.7.89  [glutamine synthetase]-adenylyl-L-tyrosine phosphorylase
     DM40_1434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnE GlnD_UR_UTase DUF294 DUF294_C
Motif
Other DBs
NCBI-ProteinID: AIO41778
LinkDB All DBs
Position
1:1561474..1564275
Genome map
AA seq 933 aa AA seqDB search
MTDASSLLSLSYSRYLARAAAARPALSDRIAAWAGAPLSRAQLDARLTELLAPPAGTAAP
GDEQLKRALRQLRVEVFGAVAERDLRGVADVAEVTGAMTDLAEVAVQRSLALLSAELDAM
YGEPRGADGQRVVLGVVGMGKLGGRELNVSSDIDLIFVYEDDGETAGGARSPLSTQEYFT
RLGRRLIGVLSEVTADGYVFRVDMRLRPNGDSGPLVCSLGMLEEYFYVQGREWERYAWIK
GRLVSEGDSDAARRLEAQLQAIVKPFVYRRYLDFGVIGAIRSLHQQIRQEAARRASMRPD
KADDIKLGRGGIREIEFSAQVFQLIRGGQDAGFRVRPTLAVLRHAQARALIGDDVRERLT
DAYNFLRTLEHRLQYRDDAQTHAMPVDPGERAALAASLGYADYAALMAVLDGHRTFVEAQ
FDQIFADKVNGGPCAAGEDTAAAWIWSGALADDGEDDALLARLDGLGFADPAAVLARLRA
IWQSSRYAGLPEKSRQRFDSVAQRALEAAPRIDAARRDETIVRLFDLLETVSRRGVYLAL
LTEYPAALDRVLSVLGATRWGGGYLIRHPQLLDELLDDEAIASPFDWPAFKDALRARLAA
ADGPEQQMDLLRHAQHAEVFRILLIDLAGQLSVEHVSDRLSELADAVLDVTIEVVWSQLA
KRHRDVPKFAVIAYGKLGGKELGYASDLDLIFLYDDPDERSADVYTTFTRRLITWLTTAT
GAGALFDIDLRLRPNGEAGLLVTDLDAFRRYQLREGDAANTAWVWEHQALTRARYSAGDP
QIGADFEAIRQQVLTTPRDAAVLANEIVDMRGKVFAGHPNHTELFDLKHDRGGMVDIEFI
VQYWVLLHASSDAELIRNTGNIALLREVARFGLMEEDEAERVGAAYRTYRKLQHKLRLDG
MEKARVDPALVADERAAVTALWERVFGARETGV
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgcttcctccctgctcagcctgtcctactcccgctacctcgcccgcgcggcc
gccgcgcgtccggcgctgtccgaccggatcgccgcgtgggccggtgcgccgctgtcccgc
gcgcagctcgacgcgcgcctgaccgaactgctcgcgccgccggccggcacggccgcaccg
ggcgacgagcagctcaagcgcgcgctgcggcagctgcgggtcgaagtgttcggtgcggtc
gcggagcgcgacttgcgcggcgtcgcggatgtcgccgaagtgacgggcgcgatgacggat
ctcgccgaagtggccgtgcagcgctcgctcgcgctgctgtcggccgaactcgacgcgatg
tacggcgagccgcgcggcgccgacggccagcgcgtcgtgctcggcgtggtcgggatgggc
aagctcggtggccgcgagctgaacgtgtcgtcagatattgacctgatcttcgtctacgag
gacgacggcgagacggccggcggcgcgcgctcgccgctgtccacccaggaatacttcacg
cggctcggccgacgcctgatcggcgtgctgtccgaggtcacggccgacggttacgtgttc
cgcgtcgacatgcggctgcgcccgaacggcgattcggggccgctcgtctgcagcctcggg
atgctcgaggaatatttctacgtgcaggggcgcgagtgggagcgctacgcgtggatcaag
gggcggctcgtgtcggagggcgacagcgacgccgcgcggcggctcgaagcgcaactccag
gcaatcgtgaagccgttcgtctaccgccgctatctcgacttcggcgtaatcggagcgatc
cgttcgctgcaccagcagatccgccaggaagccgcgcgccgcgcgtcgatgcggcccgac
aaggccgacgacatcaagctcgggcgcggcgggatccgcgagatcgaattcagtgcgcag
gtgttccagctgatccggggcggccaggatgcgggattccgcgtgcggccgacgcttgcg
gtgctgcgccacgcgcaggcgcgcgcgctgatcggcgacgacgtgcgcgaacggctcacc
gacgcgtacaacttcctgcgcacgctcgagcaccggctgcagtaccgcgacgacgcgcag
acgcacgcgatgccggtcgatccgggcgagcgcgcggcgctggccgcgtcgctcggctat
gccgactacgcggcgctgatggcggtgctcgatggccatcgcacgttcgtggaggcgcag
ttcgatcaaatcttcgcggacaaggtgaacggcggcccgtgcgcggccggcgaggacacg
gccgccgcgtggatctggagcggcgcgctcgccgacgacggcgaagacgacgcgctgctc
gcgcgcctcgacggcctcggcttcgccgatccggctgccgtgctcgcgcggctgcgcgcg
atctggcaatcgtcgcgctacgcggggctgcccgaaaagagccggcagcgtttcgacagc
gtcgcgcagcgcgcgctcgaggccgcgccgcgcatcgacgcggcgcgccgcgacgaaacg
atcgtgcggttgttcgacctgctcgagacggtcagccggcgcggcgtctatctggcgctg
ctgaccgagtatccggccgcgctcgatcgtgtactgtcggtgctcggcgcgacgcgctgg
ggcggcggctacctgatccgccatccgcagctgctcgacgaactgctcgacgacgaagcg
atcgcgagcccgttcgactggcccgcattcaaggatgcgctgcgcgcgcgcctggccgcc
gccgacggccccgagcagcagatggacttgctgcggcatgcgcagcacgcggaggtgttc
cgcatcctgctgatcgacctggcggggcaactgtcggtcgagcacgtgagcgaccgcctg
tccgaactcgccgacgcggtgctcgacgtgacgatcgaagtggtctggtcgcagctcgcg
aagcgtcaccgcgacgtgccgaaattcgcggtgatcgcgtacggcaagctcggcggcaag
gagctcggctacgcgtcggatctggacctgatctttctgtacgacgaccccgacgagcgc
tccgcggacgtctatacgacgtttacgcgccggctgatcacatggctcacgaccgcgacc
ggcgcgggcgcgctgttcgacatcgacctgcggctgcggccgaacggcgaggccggattg
ctcgtgaccgatctcgacgcgttccgccgataccagctgcgcgagggcgatgcggcgaat
accgcgtgggtgtgggagcaccaggcgctgacgcgcgcgcgctacagcgctggcgacccg
cagatcggcgcggacttcgaggcgatccgccagcaggttttaacgacgccgcgcgacgcg
gccgtgctcgcgaacgaaatcgtcgacatgcgcggcaaggtgttcgcgggccacccgaac
cacaccgagctgttcgacctgaagcacgatcgcggcgggatggtcgacatcgagttcatc
gtccagtactgggtgctcctgcatgcatcgagcgatgccgagctgatccgcaacaccggc
aacatcgcgctcttgcgcgaggtcgcacggttcggtctgatggaggaggacgaggccgag
cgggtgggcgccgcgtaccgcacgtaccggaaactgcagcacaagctgcgactcgacggg
atggagaaggcgcgggtggatccggcgctggtggccgacgagcgggcggccgtgaccgcg
ctgtgggaacgcgtgttcggggcgcgcgaaacgggcgtttga

DBGET integrated database retrieval system