KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_4163
Entry
DM40_4163         CDS       T03488                                 

Gene name
aepX
Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00440  Phosphonate and phosphinate metabolism
bcew00998  Biosynthesis of various secondary metabolites - part 2
bcew01100  Metabolic pathways
bcew01110  Biosynthesis of secondary metabolites
bcew01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bcew00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DM40_4163 (aepX)
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DM40_4163 (aepX)
Enzymes [BR:bcew01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DM40_4163 (aepX)
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Other DBs
NCBI-ProteinID: AIO39568
LinkDB
Position
2:complement(1366811..1368493)
AA seq 560 aa
MNAREPNFSESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIDGERQPLAEIDEFCGKIKAGKDSQSDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHASETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKKHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAQTGELASLACAAERLTGDTVISYGDLLFRSYILRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVAAGTPHGRWIGLLNVR
GAGVERLKAMLATLQARPDFDTLDIPALLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGGNGSAQ
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttctccgaatcgcgcagcgcacgcctgcgccgcatgctc
gtcagcagcgatctcgaatttctgatggaagcgcacaacggcctgtccgcgcgcatcgtt
cgcgaagccggcttcaaaggcatctgggcctcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaggtcgtcgacgtgctcgagttcatggcc
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgagcagcgcggcattgccggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcgacggcgaacgccagccgctcgccgagatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcaaagcgacccggacttctcg
atcgtcgcgcgtgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtacgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
cccgacgaaatcctgcagttcgcccgcgagtggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaaccacctgatccgcgcatcggcgtccgcgatgcaggccaccgcgcgcgaa
atccacgcgagcgaaacgctgatcaacgtcgaggaccgcgtcgcgtcggtcaacgaaatt
ttccgcctgcaggacgccgacgaatactcggccgccgagcgcatctacctgtcgtcgtcg
tcgcgcgcgtcgaacgccgcaattgtgctcgcggcgagccgcggcaaggggctcgaggcc
gtcaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctcctgcgctgg
ctcgtcgacggcttcaagaagcacggcgtgaacgacatcaccgtggtcggcggctatcgc
gccgacgcgatcgatacgtcgggcatcaagctcgtcgtcaacgaacgtcatgcgcagacg
ggcgagctcgcgtcgctcgcgtgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgacctgctgttccgcagctacatcctgcgcgacctcgcggagagcgaggccgag
ttcagcgtcgtcgtcgattcgtcgctcaccgaaaccaaccagagcgtgcgcgacttcgcg
ctgtgctcggccgctgacgaccgcggcctgttcggccagaagacgtatctgcaacgcgtg
tcgagcgacgttgccgccggcacgccgcatggccgctggatcggtcttctgaacgtgcgc
ggtgcgggcgtcgagcgcctgaaggcaatgctcgcgacgctgcaggcgcgcccggatttc
gacacgctcgacattccggcgctgttgaacgaactgatcgccgccggcgagaaaatcgag
gtgcagtacgtgcacggccactggcgcggtgtcaacgatctcgaggacttccgccgcgcc
ggcgacttcgcgcacggccagacgccgctgtccgagccgggcggcaacgggagcgcgcaa
tga

DBGET integrated database retrieval system