KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_5510Help
Entry
DM40_5510         CDS       T03488                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AIO37302
LinkDB All DBs
Position
3:complement(576398..577870)
Genome map
AA seq 490 aa AA seqDB search
MNRPSLNMPHADRLYIGGRWVAPASTETCAVLNCATEDVVAHAAMANEADVDAAVRAARD
AFDRGPWPHLSPAERGAFLEKIAARLEALNDDFARGWSIESGVLYRIAKPRIGLFLSGAF
RQYAAMARSYPFIAPARAVTGHQAYRVQEPVGVVAVIVPWNGPAGLLAYKIAPALLAGCT
VVIKNSPETPSSGHLFAQICDEVGLPPGVVNMLTADRTVSESLVRHPGVDKITFTGSTGA
GRRIGAVAAERVARVTLELGGKSPAVVLDDYDVETAAKVLGAPYFSYLSGQVCHSLTRII
VPRAKHDRMVDALVEAARGMVLGDPLDDATSMGPLATAAQRHVVERLVAQGVSDGARLAI
GGKRPAHLTRGFFFEPTVFANVDNRSRIAQNEFFGPVLSVIPADSEQHAIDIANDTIFGL
NAAVFTHDTERALKVARRLRAGSVGHNASRTDFSIGFGGFKQSGIGREGGTGGLEAFLES
KTVVLDQPAA
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgcccttccctgaacatgccgcacgcggatcgcctctatatcggcggccgctgg
gtggcgcccgcttccaccgagacctgcgcggtgctcaactgcgcaaccgaggacgtggtc
gcacacgcggcgatggccaacgaagccgacgtcgacgctgccgtgcgcgccgcgcgcgat
gcgttcgatcgcgggccgtggccgcatctgtcgccggccgaacgcggcgccttcctcgag
aagatcgccgcccgcctcgaagcgttgaacgacgatttcgcgcgcggctggagcatcgaa
tccggcgtgctgtaccggattgccaagccgcgcatcggcctctttctcagcggcgcgttt
cgccagtacgcggcgatggcgcgcagctatccgttcatcgcgcccgcgcgcgccgtgacg
ggccaccaggcctaccgcgtgcaggagcccgtcggcgtggtggcggtgatcgtgccgtgg
aacgggccggccgggctgctcgcctacaagatcgcgccggcgctgctcgcgggctgcacg
gtcgtcatcaagaattcgcccgagacgccgagttcgggccacctgttcgcgcagatctgc
gatgaggtcggcttgccgcccggcgtggtcaacatgctgacggccgaccggaccgtatcc
gaatcgctggtgcgtcaccccggcgtggacaagatcactttcaccggctccaccggcgct
ggccggcgcatcggcgcggtggcggccgagcgcgtcgcacgcgtcacgctcgaactcggc
ggcaaatcgcccgccgtggtactcgacgactacgacgtcgaaacggccgcgaaggtgctc
ggcgcaccgtatttcagttatctgtcgggacaggtttgtcatagcctcacgcgcatcatc
gtcccacgcgcgaagcacgaccggatggtcgacgcgctcgtcgaggccgcgcgcggcatg
gtgctcggcgacccgctcgacgacgcgacgagcatggggccgctcgcgaccgcggcgcag
cgccacgtggtcgagcggctggtcgcgcagggcgtgtccgacggcgctcggctcgcgatc
ggcggcaagcggcccgcccatctgacgcgcggcttcttcttcgaaccgacggtgttcgcg
aacgtcgacaaccgctcgcgcatcgcgcagaacgagttcttcggcccggtgctgtcggtc
atcccggccgacagcgagcaacatgcgatcgacatcgccaacgacacgatcttcggcctg
aacgccgcggtgttcacgcacgacaccgagcgggcgctgaaggttgcccgccgcttgcgc
gcgggctcggtcggccacaacgcgtcgcgcaccgatttttcgatcggcttcggcggcttc
aagcaatcgggcatcgggcgcgaaggcggcacgggcggcctcgaagcgttcctcgaatcc
aagaccgtcgtcctggaccagccggccgcctga

DBGET integrated database retrieval system