KEGG   Burkholderia cenocepacia DWS 37E-2: DM40_58Help
Entry
DM40_58           CDS       T03488                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase family protein
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
bcew  Burkholderia cenocepacia DWS 37E-2
Pathway
bcew00620  Pyruvate metabolism
bcew00680  Methane metabolism
bcew00710  Carbon fixation in photosynthetic organisms
bcew01100  Metabolic pathways
bcew01120  Microbial metabolism in diverse environments
bcew01200  Carbon metabolism
Module
bcew_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:bcew00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    DM40_58
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    DM40_58
   00680 Methane metabolism
    DM40_58
Enzymes [BR:bcew01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DM40_58
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AIO42182
LinkDB All DBs
Position
1:62559..65555
Genome map
AA seq 998 aa AA seqDB search
MKSSGSARTVRRNAALPSSDAQTGTLATAANGRAKPATKPKDPIRQTKRAIDAADTAAGT
AKRGTRTRDDKDRPLFEDIRFLGRLLGDVVREQEGDTVFDVVETIRQTAVKFRREDDSEA
AQTLEKKLRKLTPEQTVSVVRAFSYFSHLANIAEDRHHNRRRRIHALAGSAPQPGTVAYA
LEQLKTTGSASKRLLQRFFDDALIVPVLTAHPTEVQRKSILDAQHDIARLLAERDQPLTA
RERAYNESMLRARVTALWQTRMLRDARLTVGDEIENALSYYRATFLDELPALYGDIEAAL
AEHGLQARVPAFFQMGSWIGGDRDGNPNVTAATLDEAINRQAAVILEHYLEQVHKLGAEL
SVSNLLVGASDAVKALAAASPDQSPHRVDEPYRRALIGIYTRLAASARVRVGEGTVPVRS
AGRGAPPVRAVPYADSDAFVADLKVLTASLDEHHGASLAAPRLAPLVRAAEVFGFHLASI
DLRQSSDIHEAVVAELFARAGVEADYAALAEEDKLRVLLAALADPRPLRSPYLEYSALAQ
SELGVFEKAREVRAQFGARAVRNYIISHTESVSDLVEVLLLQKETGLLEGTLGSHAKNGL
MVIPLFETIPDLRDAARIMRDYFALPGIDALIAHQGAEQEVMLGYSDSNKDGGFLTSNWE
LYRAELALVDLFRERKITLRLFHGRGGTVGRGGGPTYQAILSQPPGTVNGQIRLTEQGEV
IASKFANPEIGRRNLETVVAATLEASLLPQSNAPAQLPAFEAAMQTLSDTAMASYRALVY
ETPGFTDYFFSSTPITEIAELNIGSRPASRKLQDPKNRKIEDLRAIPWGFSWGQCRLLLT
GWYGFGSAVSAYLDGAPDAAERTKRLALLKKMNKTWPFFANLLSNMDMVLAKTDLAVASR
YAQLVADRKLRKHVFERIVAEWERTSHALAEITGHEGRLATNPLLARSIKNRFPYLDPLN
HLQVELIKRHRAGDTNARLRRGIHLTINGIAAGLRNTG
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtcttccggatcggcgcgtacggtgcgccgcaatgctgccctgccctcctccgac
gcccagacgggcaccctcgccaccgccgcgaacggccgtgcgaaaccggcaacgaaaccg
aaagacccgatacgtcagacaaaacgcgcgatcgacgcagccgacaccgctgccggcacg
gcgaagcgcggcacgcgcacgcgcgacgacaaggaccgcccgctgttcgaggacatccgc
ttcctcggccgcctgctcggcgacgtcgtgcgcgaacaggaaggcgatacggtgttcgac
gtcgtcgagacgattcgccagacggcggtgaagtttcgccgcgaggacgacagcgaagcc
gcgcaaacgctggagaaaaagctgcgcaagctgacgccggagcaaacggtgagcgtcgtg
cgcgcgttcagctatttctcgcatctcgcgaacatcgcggaagaccgccaccacaaccgg
cgccgccgcatccacgcgctggcaggctccgcgccgcagccgggcaccgtcgcgtacgcg
ctcgaacagctgaaaacgaccggcagcgcatcgaagcggctgctgcagcgcttcttcgac
gatgccctgatcgtgccggtgctgaccgcgcacccgaccgaagtgcagcgcaagagcatt
ctcgacgcgcagcacgacatcgcgcgcctgctcgccgaacgcgaccagccgctgaccgcg
cgcgaacgcgcgtacaacgagtcgatgctgcgcgcgcgcgtgaccgcgctgtggcagacc
cgcatgctgcgcgacgcgcgcctgacggtcggcgacgagatcgagaacgcgctgtcgtac
taccgcgcgacgttcctcgacgaactgcccgcgctgtacggcgacatcgaggctgcgctc
gccgagcacggcctgcaggcgcgcgtgcccgcattcttccagatgggcagctggatcggc
ggcgatcgcgacggcaatccgaacgtgacagccgcaacgctcgacgaagcgatcaaccgc
caggccgcggtgatcctcgaacactatctggaacaggtgcacaagctcggcgccgagttg
tcggtgtcgaacctgctggtcggcgcgagcgacgcagtgaaggcacttgcagcggcgtcg
cccgaccagtcgccgcatcgcgtcgacgaaccgtaccgccgagcgctgatcggcatctac
acgcggctcgcggccagcgcgcgcgtgcgcgtcggcgagggcacggtcccggtgcgcagc
gccggccgcggcgcgccgccggtgcgcgcggttccgtatgcggactccgacgcattcgtc
gccgacctgaaggtgctgacggcgtcgctcgacgaacatcacggcgcgtcgctagccgcg
ccgcggctcgcgccgctcgtgcgcgcggcagaagtgttcggcttccatctcgcgagcatc
gaccttcgccagagctccgacattcacgaagccgtggtcgccgagctgttcgcgcgtgca
ggcgtcgaagccgactacgcggcgctcgccgaggaagacaagcttcgcgtactgctcgcc
gcgctcgccgatccgcgcccgctgcgctcgccatacctcgagtattcggcgctcgcgcag
agcgaactcggcgtgttcgagaaggcgcgcgaagtgcgcgcgcagttcggcgcgcgcgcg
gtgcgcaactacatcatttcgcatacggaaagcgtcagcgacctcgtcgaggtcctgctg
ctgcagaaggaaaccggcctgctcgaaggcacgctcggcagtcatgcgaagaacgggctg
atggtgatcccgctgttcgagacgatccccgacctgcgcgacgccgcgcgcatcatgcgc
gattacttcgcactgccgggcatcgatgcgctcatcgcgcaccagggcgccgagcaggaa
gtgatgctcggctactccgacagcaacaaggacggcggcttcctgacgtcgaactgggaa
ctgtatcgcgccgaactcgcgctcgtcgacctgttccgcgaacgcaagatcacgctgcgc
ctgttccatggtcgaggcggcacggtcggccgcggaggcggcccgacctaccaggcaatc
ctgtcgcagccgccgggcaccgtgaacggccagatccgcctgaccgagcagggcgaagtg
atcgcgagcaagttcgcgaacccggagatcggccggcgcaacctggagacggtcgttgcc
gcgacgctcgaggcgtcgctgctgccgcagtcgaacgcgcccgcgcagctgcccgcgttc
gaggccgcgatgcagacgctgtccgataccgcgatggcgtcgtatcgcgcgctcgtttat
gaaaccccgggcttcaccgactacttcttctcgtcgacgccgatcaccgaaatcgcggag
ctgaacatcggcagccgtccggcgtcgcgcaagttgcaggatccgaagaaccgcaagatc
gaagacctgcgcgcgattccgtggggcttctcgtgggggcagtgccggctgctgctgacc
ggctggtacggcttcggcagcgcggtgagcgcgtatctcgacggcgcgcccgacgcggcc
gagcgcacgaagcggttggcgctgctcaagaagatgaacaagacgtggccgttcttcgcg
aacctgctgtcgaacatggacatggtgctcgcaaagaccgatctcgccgttgcgtcgcgc
tacgcgcaactggtcgccgaccgcaagctgcgcaagcacgtgttcgagcggatcgtcgcc
gaatgggagcgcacgtcgcacgcgctcgccgaaatcaccggccatgaagggcgtctcgcg
accaacccgctgctcgcgcgctcgatcaagaaccgcttcccgtacctcgatccgctgaac
cacctgcaggtcgagctgatcaagcggcaccgcgcgggcgacacgaacgcgcggctgcgt
cgcgggattcacctgacgatcaacgggatcgcggccggcctgcgcaataccggctga

DBGET integrated database retrieval system