KEGG   Bacillus cereus F837/76: bcf_01405Help
Entry
bcf_01405         CDS       T01703                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00473  D-Alanine metabolism
bcf01100  Metabolic pathways
bcf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    bcf_01405
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    bcf_01405
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcf01011]
    bcf_01405
Enzymes [BR:bcf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     bcf_01405
Peptidoglycan biosynthesis and degradation proteins [BR:bcf01011]
 Precursor biosynthesis
  Racemase
   bcf_01405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEW53471
LinkDB All DBs
Position
248780..249949
Genome map
AA seq 389 aa AA seqDB search
MEEAPFYRDTWVEVDLDAIYNNVTHIKEFIPSDVEIFAVVKGNAYGHDYVPVAKTALEAG
ATRLAVAFLDEALVLRRAGITAPILVLGPSPPRDINVAAENDVALTVFQKEWVDEAIKLW
DGSSTMKYHINFDSGMGRIGIRERKELKGFLKSLEGAPFLELEGVYTHFATADEVETSYF
DKQYNTFLEQLSWLKEFGVDPKFVHTANSAATLRFQGITFNAVRIGIAMYGLSPSVEIRP
FLPFKLEPALSLHTKVAHIKQVIKGDGISYNVTYRTKTEEWIATVAIGYADGWLRRLQGF
EVLVNGKRVPIVGRVTMDQFMIHLPCEVPLGTKVTLIGRQGDEYISATEVAEYSGTINYE
IITTISFRVPRIFIRNGKVVEVINYLNDI
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcaccattttatcgtgacacttgggtggaagtggatttagatgccatttat
aacaacgttacacatattaaagaatttatcccgagtgatgtagaaatttttgccgttgtt
aaagggaatgcatatgggcacgattatgtaccggtggctaaaacagcattagaagcgggg
gcgacaaggttagcagttgcgttcttagatgaagctttagtgcttcgaagagctggtatt
actgcgccaattttggtgttaggtccttctcctcctcgtgatataaatgtagctgctgaa
aatgatgtagcattaactgtttttcaaaaggaatgggtagatgaagcaatcaaactttgg
gatggttcgtctacgatgaaataccatattaatttcgatagtggtatggggagaattgga
atacgtgaacgtaaagaattaaaaggatttttaaaaagcttagaaggtgcaccattctta
gagttggaaggagtttatacgcattttgcaacagcagatgaggtggagacttcttacttt
gataagcaatataacacatttttggagcagttaagttggttgaaagaattcggagtggat
cctaagtttgttcatacagctaatagtgctgcaacgctacgttttcaagggattacattt
aatgcagtacgaattggcattgcgatgtatgggttatctccatctgtagaaatacgccct
tttttaccgtttaaattagaaccagcgctatcattgcatacgaaagttgctcatattaaa
caggtgattaaaggggatggaattagttataacgtcacttatcgaacgaaaactgaagaa
tggattgcgaccgttgcaattggttatgcagatggctggcttagaagattacaaggattt
gaagtacttgtaaatggtaaaagggtaccgattgtagggcgagtaacgatggatcaattc
atgattcaccttccttgtgaagtgcctcttggtacgaaagttacactcattggaaggcaa
ggagatgaatatattagcgctacagaggttgcggaatattcagggactattaattatgaa
attattacgacgatcagttttcgtgtgccgagaatatttatacggaatggaaaagttgtg
gaagtaattaattatttgaacgatatatag

DBGET integrated database retrieval system