KEGG   Bacillus cereus F837/76: bcf_10245Help
Entry
bcf_10245         CDS       T01703                                 

Definition
(GenBank) Alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcf  Bacillus cereus F837/76
Pathway
bcf00473  D-Alanine metabolism
bcf01100  Metabolic pathways
bcf01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcf00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    bcf_10245
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    bcf_10245
Enzymes [BR:bcf01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     bcf_10245
Peptidoglycan biosynthesis and degradation proteins [BR:bcf01011]
 Precursor biosynthesis
  Racemase
   bcf_10245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C DUF4170
Motif
Other DBs
NCBI-ProteinID: AEW55171
LinkDB All DBs
Position
1931607..1932782
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEVDLNAVKHNVKEFKKRVNDENIAMMAAVKANGYGHGAVEVAKAAIEAG
INQLAIAFVDEAIELREAGINVPILILGYTSVAAAEEAIQYDVMMTVYRSEDLQGINEIA
NRLQKKAQIQVKIDTGMSRIGLQEEEVKPFLEELKRMEYVEVVGMFTHYSTADEIDKSYT
NMQTSLFEKAVNTAKELGIHIPYIHSSNSAGSMELSNTFQNMVRVGIGIYGMYPSKEVNH
SVVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
HALINGVRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENNETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgttgaagttgacttaaatgcagtaaaacat
aatgtaaaagaatttaaaaaacgtgtgaatgatgaaaatattgcaatgatggctgctgta
aaagcgaatgggtatggtcatggggcagttgaagttgcaaaagctgctattgaagcagga
ataaatcagcttgcaattgcatttgtagatgaagcgatagagttaagagaagcaggaatt
aacgtgccgattttaattttaggctatacatcagtagcggctgcggaagaagcaattcaa
tatgacgttatgatgaccgtttatagaagtgaagatttacaaggtataaatgaaatcgca
aaccgtcttcaaaagaaagcgcaaattcaggtgaaaattgatacaggaatgagtcgcatt
ggtttacaggaagaagaggttaaaccatttttagaggaattaaaacgtatggagtatgta
gaggtagtgggaatgtttacacattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgagaaagctgtcaatacagcaaaagaattaggaattcat
attccatatattcatagttcaaatagtgcaggttcaatggaacttagcaatacatttcaa
aatatggttcgtgtaggtatcggaatttatggaatgtatccttcaaaagaggtaaatcat
tcagttgtttcgttacagcctgcgttgtcgttaaaatcaaaagtagcccatattaagcat
gcgaagaaaaatcgcggtgtaagttatgggaatacgtatgtaacgactggtgaagaatgg
attgccactgtaccgattggttatgctgatggttataatcgtcagttatctaataaaggg
catgcattaataaatggagttcgagtacctgttattggccgtgtttgtatggatcagctc
atgttagacgtttcaaaagcaatgccagtacaagtgggagacgaagtagtattctacggt
aaacaaggcgaagaaaacatcgcagtagaagaaatagcggatatgttaggtacaattaac
tatgaagttacatgtatgttagatagaagaattccacgtgtgtataaagaaaataatgaa
acaactgctgttgtaaatatactaagaaaaaactga

DBGET integrated database retrieval system