KEGG   Bacillus cereus G9842: BCG9842_B2346Help
Entry
BCG9842_B2346     CDS       T00815                                 

Definition
(GenBank) peptide permease
Organism
bcg  Bacillus cereus G9842
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_3 Sugar_tr MFS_1_like OATP Nuc_H_symport DUF1648
Motif
Other DBs
NCBI-ProteinID: ACK94384
UniProt: B7IKM6
LinkDB All DBs
Position
2817091..2818305
Genome map
AA seq 404 aa AA seqDB search
MNYLLLRYNKPIFIRLCGELLTRTTESMLAIIMIIYVNKMLNGNVIITMLIFGLQPLSDI
LFTLIAGGITDKYGRKKIMLLGLLLQSVAIGSFVFAQSVFIFALLYVINGIGRSLYIPAQ
RAQIADLTKKEQQAEIFALLQTMGAIGSVVGPLIGASFYNTHPEYLFIVQSVTLTIYAVV
VWTQLPETVPPISMSKQTVEASSPKQFIFKHYAIFGLMVSTLPISFFYAQTETNYRIFAE
HVFLNLVFILAFISTCKAILEIILQIFLVKWSERFSMAKIILISYACYTIAAVGFSYSTT
ILSLFFTLLFLVIGESIALNHLLRFVSEIAPHDKRGLYFSIYGIHWDISRTCGPVIGAVL
LSKLNGSMLFYICASFLLVGGIVQALFVQNLERKKIANQPTHNL
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
ttgaattatctcttacttcgttacaataaacctatttttattagactgtgtggtgaatta
ttaaccagaacgactgaatctatgttagctatcattatgattatttacgtcaataaaatg
ttaaacggcaatgtaataataactatgctgattttcggattacagccactttcagacatt
ttatttacacttattgctggaggaattactgataaatatggccggaaaaagattatgtta
ctcggcttattgctacaaagtgttgcaatcggtagtttcgttttcgctcaatccgttttt
atatttgcactgttatatgtcattaatggcattggccgttccttatatattccggctcaa
cgtgcacaaattgctgatttaacaaaaaaagagcagcaagcagaaatttttgctctccta
caaacgatgggagcaattggatccgtagtcggccctttaatcggtgcaagtttttataat
actcacccagaatatttatttatcgtgcaaagtgtaacccttacgatatatgccgttgtt
gtttggacccagctcccagaaaccgttccaccaataagtatgtcaaaacaaacagttgag
gcaagttcaccaaagcaatttatttttaaacattacgccatattcggtcttatggtttct
acacttcctattagctttttttatgcacaaactgagacgaattatcgtattttcgcagaa
catgtatttcttaatctcgtattcatactcgcatttatttcaacatgtaaagccattttg
gaaatcattctacaaatcttcctcgtaaaatggtctgaacgattttctatggcgaaaatc
attcttatttcttacgcctgctatacaatagctgcagttggctttagttattcaacgacg
atattgtcgttattcttcaccttactctttttagtcattggagaaagtattgctctaaac
catttattacgattcgtttcagaaattgcacctcatgataaacgtggtttatatttttca
atttacggtatacactgggatatatctcgaacgtgtggaccagttattggtgcagtttta
ttaagtaagttaaatggaagtatgctgttttatatttgcgctagtttcttattagttgga
ggtattgtacaagcgttatttgttcaaaatttggaacgaaaaaaaatcgcaaaccagcct
acacataatttataa

DBGET integrated database retrieval system