KEGG   Bacillus cereus G9842: BCG9842_B3236Help
Entry
BCG9842_B3236     CDS       T00815                                 

Gene name
dal2
Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bcg  Bacillus cereus G9842
Pathway
bcg00473  D-Alanine metabolism
bcg01100  Metabolic pathways
bcg01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bcg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BCG9842_B3236 (dal2)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    BCG9842_B3236 (dal2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcg01011]
    BCG9842_B3236 (dal2)
Enzymes [BR:bcg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     BCG9842_B3236 (dal2)
Peptidoglycan biosynthesis and degradation proteins [BR:bcg01011]
 Precursor biosynthesis
  Racemase
   BCG9842_B3236 (dal2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ACK97015
UniProt: B7IU65
LinkDB All DBs
Position
1954147..1955322
Genome map
AA seq 391 aa AA seqDB search
MSLKYGRDTIVEIDLNAVKHNVNEFKKHVNDEKIKMMAAVKANGYGHGAVEVAKAAIEAG
INQLAVAFVDEAIELREAGITVPILILGYTPVAAVEDVIQYDVMMTVYRVEDLHGINEIA
NRLQKKVQIQVKIDTGMSRIGLQEEEVKPFLEELNRMEYVEVVGIFTHYSTADEIDKSYT
NMQTSLFEKAVNTARELGIQIPYIHSSNSAGSMELSNTFQNMVRVGIGVYGMYPSKEVDH
TIVSLQPALSLKSKVAHIKHAKKNRGVSYGNTYVTTGEEWIATVPIGYADGYNRQLSNKG
YALINGIRVPVIGRVCMDQLMLDVSKAMPVQVGDEVVFYGKQGEENIAVEEIADMLGTIN
YEVTCMLDRRIPRVYKENDETTAVVNILRKN
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaatatggaagagatacaattgtagaaattgacttaaatgctgtaaaacat
aatgtaaacgaatttaaaaaacatgtaaatgatgaaaaaattaagatgatggctgctgta
aaagcgaatgggtatggccatggggcagttgaagttgccaaagctgcaattgaagcagga
ataaatcaacttgcagttgcatttgtagatgaagcgatagaattaagagaagcaggaatt
actgtgccgattttaattttaggatacacaccagttgcggctgtagaagatgtaattcaa
tatgacgttatgatgactgtttatagagtagaagatttacatggtataaatgaaattgca
aaccgtcttcaaaagaaagtacaaattcaagtgaaaattgatacaggaatgagtcgtatc
ggtttacaagaagaagaggttaaaccatttttagaagaattaaaccgtatggagtatgta
gaggtagtagggatatttacgcattactctacggcagatgaaatcgataaatcatatacg
aatatgcaaacaagtttatttgaaaaagctgttaatacagcgagagaattaggaattcaa
ataccatatattcatagttcaaatagtgcaggatcaatggaattaagtaacacatttcaa
aatatggtacgcgttggaataggagtatacggtatgtatccgtcaaaagaagtggatcat
acaatcgtttctttacagcctgcgttgtcgttaaaatcaaaagtagctcatattaaacat
gcgaagaagaatcgcggtgtaagttatgggaatacgtatgtaacaactggtgaagaatgg
attgcgactgtaccaattggttatgctgatggttataatcgtcaattatctaataaaggc
tatgcgttaattaacgggattcgagtacctgttatcggccgtgtttgtatggatcagtta
atgctggatgtttcaaaagcgatgccagtacaagtaggagacgaagtagtattctacggt
aaacaaggtgaagaaaatatcgcagtagaagaaatagcggatatgttaggtacaataaac
tatgaagttacatgtatgctagatagaagaattccgcgtgtctataaagaaaatgacgaa
acaactgcagttgtaaatatattaagaaaaaactga

DBGET integrated database retrieval system