KEGG   Bacillus cereus G9842: BCG9842_B4193Help
Entry
BCG9842_B4193     CDS       T00815                                 

Definition
(GenBank) phage infection protein
  KO
K01421  putative membrane protein
Organism
bcg  Bacillus cereus G9842
Brite
KEGG Orthology (KO) [BR:bcg00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    BCG9842_B4193
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 Laminin_II ABC2_membrane DUF1664 Apolipoprotein Baculo_PEP_C DUF3584 ApoLp-III DUF4795 AAA_13 Prominin DUF812 Taxilin Bap31_Bap29_C SHE3 FAM184 COG6 FAP206 AIP3 Spc7 Myosin_tail_1 Lipoprotein_7 TACC_C End3 Golgin_A5 Fib_alpha FliJ
Motif
Other DBs
NCBI-ProteinID: ACK94410
UniProt: B7IL39
LinkDB All DBs
Position
1063980..1067324
Genome map
AA seq 1114 aa AA seqDB search
MMKWNQLLRKEFTEIIKSKKILIPIIAVLFVPILYAGMFLWAFWDPYKQLDDLPVAVVNL
DKGAVFDGKPIEVGKGLVDNLKDNTSFKWEFVSEKEAEKGMEGRKYYMLVRIPDDFSSNA
TTLLKDDPKPLNLEYIPNESLNFLSSQIGGTAIEKIKGEVSSTLTKTYAEKMFDSIQDVS
KGLADGAEGANKLHDGSSELHDGSSKVTDGLHTLQGKSGEMKDGAQKLADGSNKLVDGSG
KVTNGLNTLNSKTGEMQIGIGKLVDGSGKVTDGLHVLNSNVGIGKLVSGSGKVTDGLHVL
NSNAGIGKLVSGSGKVTDGLHVLNSNAGIGKLVDGSGKVTDGLHALNSNAGIGKLVDGSG
KVTNGLNMLNSKTGEMQTGIGKLVSGSGKVTDGLNTLNSKTGEMQKGIGELRDGSEKVTG
GLNELVSKSGDLKTGTTDLSNGMGKLVEGRSQLEKGSQEIQKGLQDLNSNVQKSAAGLEE
MQSKVPSILNTVNEKIDGAGANVNQLNELTQSTAGDAKTAAQDVANLQKQIESLPKEYQE
QLQPFITSAVKSTATVQQKAAGVAGGTNKLNEEVKQLKGEIHQTTNGLQNKLPNPEGVKT
LAGGIEKLTNAQNEFVSKFHGFGEGLDKAKIGANKLKDGSVQLIDGVTQLQSGSGKVTAG
LGELYAGANQMAGGINQLADGSAQVTGGLGTVSERANQMAGGINQLADGSSQVTGGLGTV
SVGVSKLADGSGQVTDGLGTVSVGVSKLADGSGQVTGGLGTVSVGVSKLADGSSQVTGGL
GTVSVAVNQLADGSSKVTGGLGTLSAGANQMSGGITQLTDGSSQVTTGLGTLNGGLNQMS
TGSTQLIDGVNKLADGSGKVTDGLVKVNDGSGELAEKLGEGAEKTGEVKGTDKTYDMFAS
PVKVKTEKMAEVPNYGTGFTPYFLSLGLFVGALLLSIVYPLRDTVGVPKSGFSWFISKFG
VLLSVGIIQAIVADVILLFGLGVEVQSIPYFILFSIVTSLAFIALIQCLVTAFGDAGRFI
AIITLIIQLTTSAGTFPLELIPKFLQPFNAWLPMTYSVSGLKAVVSSGDFNFMWQNIGML
MIFIVVLSLGTIASLTLMHKRQFKNVAENQSVEA
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaatggaatcagttacttcgtaaagagtttactgaaattataaaaagtaaaaaa
atattaattccaattatcgcggttttattcgtgccaattttatatgcaggtatgttttta
tgggccttttgggatccgtataaacagttagatgatttaccagttgcggtagtcaattta
gataaaggtgcagtatttgatgggaaaccaattgaggtcggaaaagggctcgttgataac
ttaaaagataatacaagtttcaaatgggaatttgtaagtgaaaaagaagcggaaaaagga
atggaaggtagaaagtattacatgttagtacgcattccagatgacttctcaagtaacgct
acaacgttattaaaagatgatccaaaaccattaaatttagaatacattccaaacgaaagc
ttaaacttcttatcttcacaaattggcggaacagccattgaaaaaattaaaggtgaagta
tcaagtacgttaacgaaaacatatgcagagaaaatgtttgattctattcaagacgtctca
aaaggattagcagatggggcggaaggagcaaataaactacacgacggatcaagtgagctg
catgatggttccagtaaagtgacggatggccttcatacacttcaagggaagtctggagag
atgaaggatggagctcagaaattagcagatggatctaataaattagtagatggatcaggc
aaagtaacaaatggtttaaatacgttaaatagcaaaacaggtgagatgcagataggtata
gggaaattagtagacggatctggaaaagtaacagatggtttacatgtattaaatagcaat
gtaggtatcggaaaattagtatctgggtcaggcaaagtaacagatggtttacatgtatta
aatagcaatgcaggtattgggaaactagtatctgggtcaggcaaagtaacagatggttta
catgtattaaatagcaatgcaggtattgggaaactagtagatggctccggaaaagtaacg
gatggtttacatgcattaaatagcaatgcaggtatagggaaattagtagacggttccggg
aaagtaacgaatggtttaaacatgttaaatagtaaaacaggtgagatgcaaacaggtatc
ggaaaattagtatctgggtcaggcaaagtaacagacggtttaaatacgctaaatagcaaa
acgggtgaaatgcaaaaaggaattggcgaattgcgtgatggatctgagaaagtgaccggt
ggcttgaacgaattagtaagtaaatccggtgatttaaaaacaggaacaactgatctctca
aatggtatgggaaaacttgttgaagggcgaagtcaattagaaaaagggtctcaagaaatt
caaaagggattgcaagatttaaatagtaacgtacaaaagtctgctgcaggcttagaggaa
atgcagtcgaaagttccttctatattgaatacagtaaatgaaaaaatagatggagctggg
gcgaatgtaaatcagttaaatgaacttacgcaatcaacagcaggagatgctaaaactgca
gcgcaagatgtagcgaatttacaaaagcaaattgaaagtttaccaaaagaatatcaagag
cagttacaaccgttcataacaagtgctgtaaaaagtacagcgacagttcagcaaaaggct
gccggagtagcaggtggaacaaataaactaaatgaagaagtaaaacaattaaagggcgaa
atacatcaaacaacaaatggattgcaaaataaattaccaaatccagaaggggtaaaaacg
ctagcaggtggtattgagaaactgacgaacgcacaaaatgaatttgttagtaagtttcat
ggatttggtgagggattagataaagcaaaaataggtgccaacaaattaaaagatggatca
gttcaattaattgatggagtaacgcaattacaaagcggatctggaaaagtgacagcagga
ttaggtgaattatatgctggagcaaatcaaatggcaggtggaataaatcaattagcagat
ggatctgctcaagtaacaggcggtttaggaacagtatctgaaagagcaaaccaaatggca
ggtggaataaatcaattagctgacggctcaagccaagtaacaggcggtttaggcacagta
tctgtaggagtatccaaattagcagatgggtctggtcaagtaacagacggtttaggcaca
gtatctgtaggagtatccaaattagcagatgggtctggtcaagtaacaggcggcttaggc
acagtatctgtaggagtatccaaattagcagatggctcaagtcaagtaacaggtggttta
ggaacagtatctgtagcagtaaaccaattagcagatggttcaagcaaagtaacaggcggc
ttaggtacattatccgcgggagcaaatcaaatgtcaggaggaataacgcaattaacagac
ggttcaagccaagtaacaactggcttaggtactctaaatggtggcctaaatcaaatgtca
acaggctcaacccagctaatcgacggcgtaaataaactagcagacggctcaggaaaagta
actgatggactagtgaaagtaaacgatggttcaggtgaacttgctgagaaacttggggaa
ggggcagagaaaactggggaagtaaaagggacagataaaacgtatgatatgtttgcaagt
cctgtaaaggtgaagacggagaaaatggcggaagttcctaactacggaactggatttaca
ccgtatttcttatcactcggtttattcgttggggcattactattatcaatcgtatatcca
ttacgtgatacagttggcgttccaaaatcaggatttagttggtttattagtaagttcggc
gtgttactatcagtcggtattattcaagcgatagtagcagatgttatattactgttcgga
ttaggtgtagaagtacaaagtattccgtacttcatactctttagcatcgttacaagttta
gcgtttattgcattaattcaatgtttagtaacagcattcggtgatgcagggcgtttcatc
gccatcatcacattaattattcagcttacaacaagtgctggaacattcccgttagagtta
attccgaagtttttacaaccatttaatgcttggttaccgatgacatactctgtatcagga
ttgaaagcagtcgtatcaagcggagactttaacttcatgtggcaaaacataggaatgctc
atgatctttatcgttgtattatcacttggaacaatcgcctccttaactttgatgcacaaa
cgacaatttaaaaatgttgctgaaaatcaatcggttgaagcgtaa

DBGET integrated database retrieval system