KEGG   Burkholderia cenocepacia HI2424: Bcen2424_1303Help
Entry
Bcen2424_1303     CDS       T00415                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein, PhoT family
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:bch00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bcen2424_1303
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_1303
Enzymes [BR:bch01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Bcen2424_1303
Transporters [BR:bch02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Bcen2424_1303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_23 RsgA_GTPase AAA_29 AAA_22 AAA_16 AAA_25 PRK Rad17 AAA_33 AAA_24 ATPase_2 RNA_helicase AAA_30 AAA_5 AAA_28
Motif
Other DBs
NCBI-ProteinID: ABK08055
LinkDB All DBs
Position
1:1434330..1435178
Genome map
AA seq 282 aa AA seqDB search
MNMAESHLNPVERTAAPAGTQDAAHGRPLAPLNAKIEVNNLNFFYNKFHALKNINLRIPE
GKVTAFIGPSGCGKSTLLRTFNKMFALYPEQRAEGEILMDGENLLTTKRDISLLRARIGM
VFQKPTPFPMSIYDNIAFGVKMFEKLTRSEMDDRVEWALTKAALWNEVKDKLGQSGYGLS
GGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELIAELKSDYTVVIVTHNMQQA
ARCSDYTAYMYLGELIEFGETEKIFIKPVRKETEDYITGRFG
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgaatatggcagaaagccacctgaatcccgtcgagcgcaccgctgcgcccgccggcacg
caagacgcggcgcacggccgtccgctcgcgccgctgaacgcgaagatcgaggtcaacaac
ctcaacttcttctacaacaagttccacgcgctgaagaacatcaacctgcgcattcccgaa
gggaaggtgacggcgttcatcggcccgtcgggctgcggcaagtcgacgctgctgcgcacg
ttcaacaagatgttcgcgctctatccggagcagcgcgccgaaggcgagatcctgatggac
ggcgagaacctgctgacgacgaagcgcgacatctcgctgctgcgcgcgcggatcggcatg
gtgttccagaagccgaccccgttcccgatgtcgatctacgacaacatcgcgttcggcgtg
aagatgttcgaaaagctcacgcgctcggaaatggacgaccgtgtcgagtgggcgctcacg
aaggccgcgctgtggaacgaagtgaaggacaagctgggccagagcggctacgggctgtcg
ggcggccagcagcagcgtctgtgcatcgcgcgcggcatcgcgatccgtccggaagtgctg
ctgctcgacgagccgtgctcggcgctcgacccgatctcgacgggccgcatcgaagagctg
atcgcggagctgaagagcgactacacggtcgtgatcgtcacgcacaacatgcagcaggcc
gcacgctgctcggattacacggcctacatgtacctgggcgagctgatcgagttcggcgag
accgaaaagatcttcatcaagccggtgcgcaaggaaacggaagactacatcaccggccgc
ttcggctga

DBGET integrated database retrieval system