KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2039Help
Entry
Bcen2424_2039     CDS       T00415                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00473  D-Alanine metabolism
bch01100  Metabolic pathways
bch01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Bcen2424_2039
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Bcen2424_2039
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bch01011]
    Bcen2424_2039
Enzymes [BR:bch01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Bcen2424_2039
Peptidoglycan biosynthesis and degradation proteins [BR:bch01011]
 Precursor biosynthesis
  Racemase
   Bcen2424_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ABK08790
LinkDB All DBs
Position
1:complement(2263151..2264221)
Genome map
AA seq 356 aa AA seqDB search
MPRPISATIHTAALANNLSVVRRFAGPSKVWAVVKANAYGHGLARAFPGLRGTDGFGLLD
LDEAVKLRELGWAGPILLLEGFFRSTDIDVIDRYSLTTTVHNDEQMRMLETARLSKPVNV
QLKMNSGMNRLGYVPEKYRAAWERARACPGIGQITLMTHFSDADNERGVAEQLATFERGA
ESIAGARSLANSAAVLWHPDTHFDWVRPGIVLYGASPSGLSSDIADTGLKSAMTLASELI
AVQTIGKGQAIGYGSTFSAQAPMRIGVVACGYADGYPRVAPEGTPVIVDGIRTRIVGRVS
MDMITVDLTPCPQAGVGARVELWGNALPIDDVARHCGTIGYELMCAVAARVPVRAE
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgcccgatctccgccaccatccacaccgccgctctcgcgaacaatctctccgtc
gtccgccgctttgccggcccgtccaaggtctgggcggtcgtcaaggccaacgcgtacggc
cacggtctcgcccgcgcgtttccgggcctgcgcggcaccgacggcttcggcctgctcgac
ctcgacgaggcggtgaagctgcgcgagctcggctgggccggcccgatcctgctgctcgaa
ggcttcttccgctcgaccgacatcgacgtgatcgaccgctacagcctgaccacgaccgtc
cacaacgacgagcagatgcggatgctggaaacggcgcggctgtcgaagcccgttaacgtg
cagctcaagatgaacagcgggatgaaccggctcggttacgtgccggaaaaataccgtgcc
gcgtgggagcgcgcccgcgcgtgccccggcatcggccagatcacgttgatgacccatttt
tcggacgcggacaacgagcgcggtgtcgccgagcagctcgcgacgttcgagcgcggcgcg
gaaagcatcgccggcgcgcgcagtctcgcgaattcggccgccgtgctgtggcatccggat
acgcacttcgactgggtgcgtccggggatcgtgctgtatggcgcgtcgccgtccgggttg
tcgtccgatatcgcggacacggggttgaagtccgcgatgacgcttgcatccgagctgatc
gcggtgcagacgatcgggaagggccaggcgatcggttatggttcgacgttttcggcgcag
gcgccgatgcggatcggcgtcgtcgcgtgcggctatgcggatggctatccgcgcgtggcg
cccgaaggcacgcccgtgatcgtcgacggcatccgtacgcggatcgtcggccgcgtgtcg
atggacatgatcaccgtcgacctgacgccgtgcccgcaggccggcgtcggcgcgcgcgtc
gagctgtggggcaacgcgctgccgatcgacgacgtcgcgcgccattgcggcacgatcggc
tacgagctgatgtgcgcggtcgcggcccgcgtgcccgtgcgagcggaataa

DBGET integrated database retrieval system