KEGG   Burkholderia cenocepacia HI2424: Bcen2424_2524Help
Entry
Bcen2424_2524     CDS       T00415                                 

Definition
(GenBank) isocitrate dehydrogenase (NADP)
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00020  Citrate cycle (TCA cycle)
bch00480  Glutathione metabolism
bch01100  Metabolic pathways
bch01110  Biosynthesis of secondary metabolites
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
bch01200  Carbon metabolism
bch01210  2-Oxocarboxylic acid metabolism
bch01230  Biosynthesis of amino acids
Module
bch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bch_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcen2424_2524
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcen2424_2524
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     Bcen2424_2524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-ProteinID: ABK09274
LinkDB All DBs
Position
1:complement(2798119..2799375)
Genome map
AA seq 418 aa AA seqDB search
MPYQHIKVPEGGDKITVNKDFSLNVSDQPIIPYIEGDGTGFDITPVMIKVVDAAVAHAYK
GKRKIHWMEIFAGEKATKVYGPDVWLPDETLQVLKEYVVSIKGPLTTPVGGGIRSLNVAL
RQELDLYVCLRPVQYFKGVPSPVREPQKIDMVIFRENSEDIYAGIEWAAGSEQAKKVIKF
LQDEMGVKKIRFPETSGIGVKPVSTEGTERLVRKAIQYAIDNDRKSVTLVHKGNIMKFTE
GLFRDAGYALAQKEFGGELIDGGPWMRVKNPKTGNEIVIKDSIADAFLQQILLRPAEYDV
IATLNLNGDYISDALAAQVGGIGIAPGANLSDSVAMFEATHGTAPKYAGKDYVNPGSEIL
SAEMMLRHLGWTEAADTIIAAMEKSILQKRVTYDFARLMEGATQVSCSGFGEVLIENM
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgccgtatcagcacatcaaggttccggagggcggtgacaagatcaccgtcaacaaggac
ttctcgctcaacgtttccgatcagccgatcattccctatatcgaaggcgacggtacgggc
ttcgatatcacgccggtcatgatcaaggtcgtcgatgcggcggtcgcgcatgcgtacaag
ggcaagcgcaagatccactggatggagatcttcgcgggcgagaaggcgaccaaggtgtac
ggtccggacgtgtggctgccggacgaaacgctgcaggtcctgaaggaatacgtggtgtcg
atcaaggggccgctcacgaccccggtcggcggcggcatccgttcgctgaacgtcgcgctg
cgccaggagctcgatctgtacgtgtgcctgcgcccggtccagtacttcaagggcgtgccg
tcgccggtgcgtgagccgcagaagatcgacatggtgatcttccgcgagaactcggaagac
atctacgcgggcatcgaatgggccgcgggctccgagcaggcgaagaaggtgatcaagttc
ctgcaggacgagatgggcgtgaagaaaatccgcttcccggaaacttccgggatcggcgtc
aagcccgtgtcgaccgaaggcaccgagcgtctcgtgcgcaaggcgatccagtacgcgatc
gacaacgatcgcaagtcggtcacgctggtgcacaagggcaacatcatgaagttcacggaa
ggcctgttccgtgacgccggctacgcgctcgcgcagaaggaattcggcggcgagttgatc
gacggcggcccgtggatgcgcgtgaagaacccgaagacgggcaacgagatcgtgatcaag
gattcgatcgccgatgccttcctgcagcagatcctgctgcgcccggccgaatacgacgtg
atcgcgacgctgaacctgaacggcgactacatctccgacgcgctggccgcgcaggtcggc
ggcatcgggatcgcgcctggcgcgaacctgtcggattcggtcgcgatgttcgaggcgacg
cacggcacggcgccgaagtacgcgggcaaggattacgtgaaccccggttccgagatcctg
tcggcggaaatgatgctgcgccacctcggctggacggaagcagccgacacgatcatcgcc
gcgatggagaagtcgattctgcagaagcgcgtcacgtacgacttcgcgcgcctgatggaa
ggcgcgacgcaggtgtcgtgctccggcttcggcgaagtgctgatcgagaacatgtaa

DBGET integrated database retrieval system