KEGG   Burkholderia cenocepacia HI2424: Bcen2424_3847Help
Entry
Bcen2424_3847     CDS       T00415                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Bcen2424_3847
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bch02000]
    Bcen2424_3847
Enzymes [BR:bch01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Bcen2424_3847
Transporters [BR:bch02000]
 Other Transporters
  Pores ion channels [TC:1]
   Bcen2424_3847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: ABK10584
LinkDB All DBs
Position
2:complement(710117..710818)
Genome map
AA seq 233 aa AA seqDB search
MMAFPPPSGLDMLTVHHLNNSRSQRVLWLLEELDVPYEIVRYERDPKTMLAPAELRAIHP
LGKSPVVTDDGRTFAESGAIIEYLVERYGNGRLAPPPGSPERHDYTYWLHYAEGSAMPPL
LLKLVALRIAHAPMPFFARPIARKIAATLQSGFVDPQIDLHLGHVDGALARSGWFVGDGF
SAADIQMSFPLEAATARGGGSRYPAIARFLDTIHARPAYQRALERGGRYDLLK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgatggcgttcccgcccccttccggcctcgacatgctcaccgtccatcacctgaacaac
tcgcgttcgcagcgcgtgctctggctgctcgaagaactggatgtgccgtacgagatcgtg
cgctacgaacgcgatccgaaaacgatgctcgcgccggccgaattgcgcgcgatccatccg
ctcggcaagtcgcctgtcgtgaccgacgacggccgcaccttcgccgaatcgggcgcgatc
atcgaatacctggtcgaacgctacggcaacgggcgcctcgcgccgccgcccggctcgccc
gagcggcacgactacacgtactggctgcactacgcggaagggtcggcgatgccgccgctg
ctgctcaagctcgtcgcgctgcggatcgcgcatgcgccgatgccgttcttcgcgcggccg
atcgcacgcaagatcgccgcgacgctgcagtcgggtttcgtcgatccgcagatcgacctg
catctcggccacgtcgacggtgcgctggcgcgcagcggctggttcgtcggcgacggcttc
agcgcggccgacatccagatgagctttccgctcgaagccgcgaccgcgcgcggcggtggc
agccggtatccggcgatcgcgcgctttctcgacacgatccatgcgcggcccgcgtaccag
cgcgcgctggagcgcggcggccggtacgacctgctcaagtaa

DBGET integrated database retrieval system