KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4121Help
Entry
Bcen2424_4121     CDS       T00415                                 

Definition
(GenBank) 2,3-dimethylmalate lyase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00440  Phosphonate and phosphinate metabolism
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
bch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Bcen2424_4121
Enzymes [BR:bch01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Bcen2424_4121
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase
Motif
Other DBs
NCBI-ProteinID: ABK10857
LinkDB All DBs
Position
2:complement(1028140..1029825)
Genome map
AA seq 561 aa AA seqDB search
MNAREPNFTESRSARLRRMLVSSDLEFLMEAHNGLSARIVREAGFKGIWASGLAISAQFG
VRDNNEASWTQVVDVLEFMADASDLPILLDGDTGYGNFNNVRRLVKKLEQRGIAGVCIED
KQFPKTNSFIGGERQPLAEIDEFCGKIKAGKDSQTDPDFSIVARVEALIAGWGMDEALRR
ANAYAEAGADAILIHSKLSRPDEILQFAREWSGKAPLVIVPTKYYSTPTDVFRQAGISTV
IWANHLIRASASAMQATAREIHESETLINVEDRVASVNEIFRLQDADEYSAAERIYLSSS
SRASNAAIVLAASRGKGLEAVTEDKPKVMLPVAGKPLLRWLVDGFKTHGVNDITVVGGYR
ADAIDTSGIKLVVNERHAETGELASLACAAERLTGDTVISYGDLLFRSYIVRDLAESEAE
FSVVVDSSLTETNQSVRDFALCSAADDRGLFGQKTYLQRVSSDVATSTPHGRWIGLLNVR
GAGVDRLKAMLATLQARPDFDTLDIPSLLNELIAAGEKIEVQYVHGHWRGVNDLEDFRRA
GDFAHGQTPLSEPGTGNGGAQ
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcacgcgaacccaacttcaccgaatcacgcagcgcgcgcctgcgccgcatgctc
gtcagcagcgatctcgaattcctgatggaagcgcacaacggcctgtccgcgcggatcgtc
cgcgaggccggcttcaagggtatctgggcgtcgggcctcgcgatctccgcgcagttcggc
gtgcgcgacaacaacgaagcgagctggacgcaagtcgtcgacgtgctcgaattcatggct
gacgcgagcgacctgccgatcctgctcgacggcgacaccggctacggcaacttcaacaac
gtgcgccgcctcgtgaagaagctcgaacagcgcggcatcgcgggcgtgtgcatcgaggac
aagcagttcccgaagacgaacagcttcatcggcggcgagcgccagccgctcgcggaaatc
gacgagttctgcggcaagatcaaggccggcaaggattcgcagaccgatcccgacttctcg
atcgtcgcgcgcgtcgaggcgctgatcgcgggctgggggatggacgaggcgctgcgccgc
gcgaacgcgtatgcggaagccggcgccgacgcgatcctgatccacagcaagctgtcgcgc
ccggacgagatcctgcagttcgcgcgcgaatggagcggcaaggcgccgctcgtgatcgtg
ccgaccaagtactacagcacgccgaccgacgtgttccgccaggccggcatcagcaccgtg
atctgggcgaatcatctgatccgcgcgtcggcatccgcgatgcaggcgaccgcgcgcgag
atccacgagagcgaaacgctgatcaacgtcgaggaccgcgtggcatcggtcaacgagatc
ttccgcctgcaggacgccgacgagtactcggccgccgagcgtatctacctgtcgtcgtcg
tcgcgcgcgtcgaatgccgcgatcgtgctcgccgcgagccgcggcaagggcctcgaagcc
gtgaccgaagacaagccgaaggtcatgctgccggtcgccggcaagccgctgctgcgctgg
ctcgtcgacggcttcaagacgcatggcgtaaacgacatcaccgtggtcggcggctatcgc
gccgatgcgatcgatacgtcgggcatcaagctcgtcgtcaacgagcgccacgcggaaacg
ggcgagctcgcgtcgctcgcctgcgcggccgaacgcctgaccggcgacaccgtgatctcg
tacggcgatctgctgttccgcagctacatcgtgcgcgacctcgcggagagcgaggccgag
ttcagcgtggtggtcgattcgtcgctcaccgagaccaaccagagcgtgcgcgacttcgcc
ctctgctcggcggccgacgatcgcggcctgttcggccagaagacctacctgcaacgtgtg
tcgagcgacgtcgccacgagcacgccgcacggccgctggatcggcctgctgaacgtgcgc
ggcgcgggcgtcgatcgcctgaaggcgatgctcgcgacgctgcaggcgcgccctgatttc
gacacgctcgacattccgtcgctgctgaacgaactgatcgccgccggcgagaagatcgag
gtgcagtacgtgcacggccactggcgcggcgtcaacgacctggaagacttccgccgcgcg
ggcgacttcgcgcacggccagacgccgctgtccgaaccgggcaccggcaacgggggcgcg
caatga

DBGET integrated database retrieval system