KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4523Help
Entry
Bcen2424_4523     CDS       T00415                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcen2424_4523
Enzymes [BR:bch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Bcen2424_4523
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Bcen2424_4523
    1.1.1.-  
     Bcen2424_4523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C DAO
Motif
Other DBs
NCBI-ProteinID: ABK11257
LinkDB All DBs
Position
2:1479551..1480648
Genome map
AA seq 365 aa AA seqDB search
MSTPAPNIASSMKAAVWHGRHDIRVEEVPVPERPPAGWVTIRVHWCGICGSDLHEYVAGP
VFIPVDAPHPLTGLKGQCILGHEFSGEIAELGAGVSGYAVGDRVTADACQHCGTCWYCRH
GLYNICENLAFTGLMNNGAFAEYVNVPAELLYKLPDNFPTEAGALIEPLAVGLHAVKKAG
NIVGQTVVVVGAGTIGLCTIMCAKAAGAGRVIALEMSAARKQKALEVGASVVIDPKTSDA
IAEVRALTGGYGADVSFECIGHTATAKLAIDVIRKAGKAVMVGIFEEPAPFNFFDIVSTE
KEVIGSLAYNGEFADVIRFIADGRIDVQPLITGRIALGDIVAHGFEELVNHKDRNVKIIV
QPAVA
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
gtgagtacaccggcaccgaacatcgcatccagcatgaaggccgccgtctggcatggccgc
cacgacatccgcgtcgaagaggttcccgttccggagcgcccgcccgccggctgggtcacg
atccgcgtgcactggtgcggcatctgcggctccgacctgcacgaatacgtcgccgggccg
gtgttcatcccggtcgacgcgccgcatccgctgaccggcctgaagggccagtgcatcctc
ggccacgagttcagcggcgagatcgccgagctcggcgcgggcgtgtcgggttacgcggtc
ggcgaccgcgtgacggccgacgcgtgccagcattgcggcacctgctggtattgccggcac
gggctgtacaacatctgcgagaacctcgcgttcaccgggctgatgaacaacggtgcgttt
gccgaatacgtgaacgtgccggccgaactgctgtacaagctgccggacaatttcccgacc
gaggccggcgcgctgatcgaaccgctcgcggtcgggctgcacgcggtgaagaaggccggc
aacatcgtcgggcagaccgtcgtcgtggtcggcgcgggcacgatcggcctgtgcacgatc
atgtgcgcgaaggcggcgggcgccgggcgcgtgatcgcgttggagatgtcggccgcgcgc
aagcagaaggcgctggaggtgggcgcgagcgtcgtcatcgatccgaagacgtccgacgcg
atcgccgaagtcagggcgctgaccgggggctacggcgccgacgtgtcgttcgaatgcatc
gggcacacggccaccgcgaagctcgcgatcgacgtgatccgcaaggccggcaaggcggtg
atggtcggcatcttcgaggaaccggcgccgttcaacttcttcgacatcgtgtcgaccgag
aaggaagtgatcggctcgctcgcgtacaacggcgaattcgcggacgtgatccgcttcatc
gccgacggccgcatcgacgtgcagccgctcatcaccgggcgcatcgcgctcggcgacatc
gtcgcgcacggcttcgaggagctggtcaaccacaaggaccgcaacgtgaagatcatcgtc
cagccggccgtcgcctga

DBGET integrated database retrieval system