KEGG   Burkholderia cenocepacia HI2424: Bcen2424_4930Help
Entry
Bcen2424_4930     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, LysR family
  KO
K17850  LysR family transcriptional regulator, regulator of gene expression of beta-lactamase
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:bch00001]
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Bcen2424_4930
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bch03000]
    Bcen2424_4930
Transcription factors [BR:bch03000]
 Prokaryotic Type
  Helix-turn-helix
   LysR family
    Bcen2424_4930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LysR_substrate HTH_1
Motif
Other DBs
NCBI-ProteinID: ABK11664
LinkDB All DBs
Position
2:1928087..1928977
Genome map
AA seq 296 aa AA seqDB search
MTKLRPHLPLNALRAFESSARHLNFTRAGLELSVTQAAVSQQVRSLEERLGCTLFTRLPR
GLGLTDEGRALLPVLSDAFSRIETVLKQFDGGRFHEVLTLGVVGTFALGWLMPRLKQFGD
THPFVELRLRTNNNVVDLAAEGLDFAIRFGVGNWPATRNERLLDAPLTALCTPDIARRLA
QPADLANETLLRSYRTDEWLGWFDAAQLEPWAVNGPVFDSSRLMVEAAMQGAGIALAPAC
MFARELQLGLLARPLDIDVRAGGYWLTSLKSKPLTPAMTLFRDWIVAEAASAAPTE
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagctccgccctcatcttccgctcaatgcgttgcgcgcgttcgaatcgtcggcg
cgccacctgaacttcacgcgcgccggcctcgaactgagcgtgacccaggccgccgtcagc
cagcaggtgcgctcgctcgaggagcgactcggctgcacgctgtttacgcgtctgccgcgc
ggcctcgggctgaccgacgaggggcgcgcactgctgccggtgctgagcgacgcgttcagc
cgcatcgagacggtgctcaagcagttcgacggcgggcgtttccacgaggtgctgacgctc
ggcgtcgtcggcacctttgccctaggctggctaatgccgcggctgaagcagttcggcgac
acgcacccgttcgtcgagctgcggctgcggaccaacaacaacgtcgtcgatctcgccgcc
gagggcctcgatttcgcgatccgctttggcgttggcaactggccggcgacgcgcaacgag
cggctgctcgatgcgccgctcaccgcgctgtgcacgccggacatcgcacggcgcctcgcg
cagccggccgatctcgcgaacgaaacgttgctgcgctcgtatcgcaccgacgaatggctc
ggctggttcgacgccgcgcagctcgaaccgtgggccgtcaacgggcccgtgttcgattcg
tcccggctgatggtcgaggccgcgatgcagggtgcgggcatcgcgctcgcccccgcctgc
atgttcgcgcgcgaactgcagctcggcctgctcgcacgaccgctcgacatcgacgtgcgc
gccggcggctactggctcacgtcgctgaagtcgaaaccgctgacgcccgcgatgacgctc
tttcgcgactggatcgtggcggaagcggcgagcgccgcgcccaccgaatag

DBGET integrated database retrieval system