KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5361Help
Entry
Bcen2424_5361     CDS       T00415                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase apoenzyme
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
bch  Burkholderia cenocepacia HI2424
Pathway
bch00250  Alanine, aspartate and glutamate metabolism
bch00410  beta-Alanine metabolism
bch00640  Propanoate metabolism
bch00650  Butanoate metabolism
bch01100  Metabolic pathways
bch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    Bcen2424_5361
   00650 Butanoate metabolism
    Bcen2424_5361
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcen2424_5361
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bcen2424_5361
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bch01007]
    Bcen2424_5361
Enzymes [BR:bch01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     Bcen2424_5361
Amino acid related enzymes [BR:bch01007]
 Aminotransferase (transaminase)
  Class III
   Bcen2424_5361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ABK12094
LinkDB All DBs
Position
2:2455399..2456688
Genome map
AA seq 429 aa AA seqDB search
MTVKNADLQARKNAATPRGVGVMCDFYAARAENAELWDVEGRRFIDFAAGIAVLNTGHRH
PKIVKAIADQLNNFTHTAYQIVPYASYVELAEKINERAPGDFPKKTAFFTTGAEAVENAI
KIARAATGRPGVIAFSGGFHGRTMMGMALTGKVAPYKLNFGPFPGDVFHAPYPNAVHGVT
TADSIKAIEMLFKADIDPKRVAAIIFEPVQGEGGFNPAPAEFVRALRKICNEHGILLIAD
EVQTGFARTGKLFAMQHYDVLADLITMAKSLAGGMPLSGVVGRADVMDAAAPGGLGGTYA
GNPLAVASAHAVLEIIDEEKLCERATQLGDVLKAKLNALQADVPQIADVRGPGAMIAVEF
LKPGSGEPDAEFTKRVQTRALERGLLLLVCGVYSNVVRFLFPLTIPQAVFDEALVILEEV
LKETVGVPA
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtgaagaatgccgacctgcaggcccgcaagaacgccgccaccccgcgcggcgtc
ggcgtgatgtgcgatttctacgccgcccgcgccgagaacgcggagctgtgggatgtcgaa
ggccgccgcttcatcgatttcgccgccggcatcgcggtgctgaacacgggccaccgtcac
ccgaagatcgtcaaggcgatcgccgatcagctgaacaacttcacgcacaccgcttaccag
atcgtcccgtacgcgtcgtacgtcgaactggcggaaaagatcaacgagcgcgcgccgggc
gacttcccgaagaagacggcgttcttcacgaccggcgccgaagccgtcgaaaacgcgatc
aagatcgcgcgcgcggcaaccggccgtccgggcgtcatcgcattctcgggcggcttccac
ggccgcacgatgatgggcatggcgctgaccggcaaggtcgcgccgtacaagctgaacttc
ggcccgttcccgggcgacgtgttccacgcgccgtacccgaacgccgtgcacggcgtgacg
accgccgactcgatcaaggcgatcgagatgctgttcaaggccgacatcgatccgaagcgc
gtcgccgcgatcatcttcgaaccggtccagggcgaaggcggcttcaacccggcgccggcc
gaattcgtgcgcgcgctgcgcaagatctgtaacgaacacggcatcctgctgatcgccgac
gaagtgcagacgggcttcgcgcgcaccggcaagctgttcgcgatgcagcactacgacgtg
ctggccgacctgatcacgatggcgaagagcctcgcgggcggcatgccgctgtcgggcgtc
gtcggccgggcggacgtgatggacgcggccgcccccggcggcctcggcggcacctacgcg
ggcaacccgctggcagtcgcctcggcgcacgcggtgctcgagatcatcgacgaagagaag
ctgtgcgagcgtgcgacgcaactcggcgacgtgctgaaggcgaagctgaatgcgctgcag
gccgacgtgccgcagatcgccgacgtgcgcggccccggcgcgatgatcgcggtcgaattc
ctgaagccgggttcgggcgagccggatgccgaattcacgaagcgcgtgcagacgcgtgcg
ctcgagcgcggcctgctgctgctcgtgtgcggcgtgtactcgaacgtcgtgcgcttcctg
ttcccgctgacgatcccgcaagccgtgttcgacgaagcgctggtgatcctcgaggaagtg
ctgaaggaaacggtcggcgtgccggcctga

DBGET integrated database retrieval system