KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5728Help
Entry
Bcen2424_5728     CDS       T00415                                 

Definition
(GenBank) Cupin 2, conserved barrel domain protein
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cupin_2 Cupin_7 AraC_binding
Motif
Other DBs
NCBI-ProteinID: ABK12461
LinkDB All DBs
Position
2:complement(2851437..2851970)
Genome map
AA seq 177 aa AA seqDB search
MVDKAVSEFWQNIPAIANPFKPDALPEAYIPNAATDDERYYVPFTETVSSRPLWISPSQN
KWCDILMAKEAGLVNRHYHPHEVFAYTLSGKWGYLEHEWTATRGDFVYETPGEGHTLVAF
DHPEPMRAFFIVKGPLIWLDDAGNPDGYFDVHSYIAMCKAHYEKVGLGAQAVEKLFR
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacaaagccgtatccgaattctggcaaaacattccggcgattgccaatccgttc
aagcccgatgcgctgcccgaagcctacatcccgaacgcggccaccgacgacgagcgctat
tacgttccgttcaccgaaacggtttcgtcgcggccgctgtggatctcgccgtcgcagaac
aaatggtgcgacatcctgatggcgaaggaagccgggctcgtgaaccggcactatcacccg
cacgaggtgttcgcgtacacgctgtcggggaaatggggttacctcgaacacgaatggacc
gcgacgcgcggcgatttcgtgtacgagacgccgggcgagggccacacgctcgtcgcgttc
gatcaccccgagccgatgcgcgcgttcttcatcgtcaagggcccgctgatctggctcgac
gacgcaggcaatcccgacggctacttcgacgtgcattcgtacatcgcgatgtgcaaggcg
cattacgagaaggtcggcctcggcgcgcaagcggtcgagaagctgttccgctga

DBGET integrated database retrieval system