KEGG   Burkholderia cenocepacia HI2424: Bcen2424_5729Help
Entry
Bcen2424_5729     CDS       T00415                                 

Definition
(GenBank) transcriptional regulator, AraC family
Organism
bch  Burkholderia cenocepacia HI2424
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AraC_binding_2 HTH_18 HTH_AraC
Motif
Other DBs
NCBI-ProteinID: ABK12462
LinkDB All DBs
Position
2:2852147..2853127
Genome map
AA seq 326 aa AA seqDB search
MTNSTVFSRTRGSTADVPARDRMAYWDAFNAATLVGLRCSSLSPAGLEAEKTDIALPGLG
IADISGQDHVIERSPALVRQLPKESLFACQILSGRAYFIQHDRCLLAEAGDLVVYDTRVP
YLFGFLTPMRQLLIDIPITTFDDRLDAELAALPLRIAPKPGAGAMLGATLRASVERFMKA
PVERDAARFAEHTRTLIAELIDAEVNGAGASRASLSYLLTAKQYIATHLGEPELAPQAVA
DAVGLSLRHLGRLFAAEGESITQHIWSERLSHAHRELTDARLRKTSIGEIAFRWGFSSQA
HFSRAIRERYGASPMALRDAAREAAG
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaattcgaccgttttttcacgcacgcgaggctcgacggccgacgtgccggcgcgt
gaccggatggcgtactgggatgcgttcaacgcagcgacgctggtcggcctgcgctgctcg
tcgctgtcgccggccgggctggaagccgagaagaccgatatcgcgctgccgggcctcggc
atcgccgacatcagcgggcaggatcacgtgatcgagcgcagccccgcgctggtgcgccag
ttgccgaaggagtcgctgttcgcgtgccagatcctgagcgggcgcgcgtatttcatccag
cacgaccggtgcctgctcgcggaggccggcgatctcgtcgtctacgacacccgcgtgccg
tatctgttcggattcctcacgccgatgcggcagttgctgatcgatatcccgatcacgacg
ttcgacgaccgcctcgatgcggaactggccgcgctgccgctgcggatcgcgccgaagccg
ggcgcgggcgcgatgctcggcgcaacgttgcgcgcgagcgtcgagcggttcatgaaggcg
ccggtggagcgcgacgccgcgcggttcgccgagcacacgcgcacgctgatcgcggaactc
atcgacgcggaagtgaacggtgcgggcgcctcgcgcgcgtcgctgtcgtacctgctgacc
gcgaagcagtacatcgcgacgcatctgggcgagccggagctcgcgccgcaggccgtcgcc
gacgcggtcgggctgtcgctgcggcatctgggccgcctcttcgcggccgaaggcgagtcg
atcacgcagcacatctggtcggaacggctgtcgcacgcgcatcgcgagctgacggatgcg
cggctgcgcaagacgagcatcggcgagatcgcgttccgctgggggttttcgagccaggcg
catttcagccgcgcgatccgcgagcgctacggcgcgtcgccgatggcgctgcgcgatgcg
gcgcgcgaggccgcgggctga

DBGET integrated database retrieval system