KEGG   Borreliella chilensis: OY14_01195Help
Entry
OY14_01195        CDS       T03543                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
bchi  Borreliella chilensis
Pathway
bchi00564  Glycerophospholipid metabolism
bchi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bchi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    OY14_01195
Enzymes [BR:bchi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     OY14_01195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored HI0933_like Pyr_redox_2 NAD_binding_8 GIDA Pyr_redox_3 Pyr_redox Thi4 FAD_binding_3 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AJA90073
UniProt: A0A0A7UXH6
LinkDB All DBs
Position
246872..248434
Genome map
AA seq 520 aa AA seqDB search
MNNNKETKLKDLENQEFDLIIIGGGATGLGIAVDAITRGYKVILIEKFDYAKGTSSRSSK
LIHGGVRYLAQWNIPLVKEALHEKAILEKNAPHLINECAFITPIYNILEIPYYYFGLSYY
HNLMGKEKAAKYKTKLLSRTSTIEKAPNIKTEGLKCSVLYYDDSFDDARMAITLLRTFTE
KGGIALNYTELKKFRKENGKLSGVIIQNKLSKEQISLKSKCVINATGIFSDQIRRLDDEK
TLNIIKPSQGSHLIIKKDKFPQNHAILMPKTSDNRILFAIPWYGSVVCGSTDISIKEIEE
EPKRLDEEIDFIINNLNNYLNIKIEKSDIKSVYTGIRPLIIDPKAGGNTSKISRNEKIFI
SDSNLITIAGGKYTTYRKMAEKTLLKAIENDLIPNYPPTTEDLKLHGYLKKEEAIKIPEA
FRAYGSDFEILKNMEGFDKNIHENLDLNEAQITFSIKFEQAKTIDDVLARRTRSLPLNPQ
ATIEAAPKVAEIMMKKLNKSEEWKNEQIKSFLEISKKYLI
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaacaaagaaacaaaattaaaagatctcgaaaatcaagaatttgacctcata
ataatcggaggaggcgcaacaggacttggtatagcagtagacgcaataacaagaggatac
aaagtaatacttatagaaaaatttgattatgcaaaaggaacttcttctaggtcaagtaaa
ttaattcacggcggagtaaggtatttagctcaatggaatatccctttagttaaagaagct
ttacacgaaaaagcaattcttgaaaaaaatgcaccccatttaattaatgaatgtgccttt
attactcccatttataatattttagaaataccttattattattttggattaagttattac
cataatcttatgggaaaagaaaaagctgccaaatacaaaaccaaattactctcaagaaca
tctactattgaaaaagctcctaatattaaaacagaaggccttaaatgttctgttttatat
tatgatgattcattcgatgatgctagaatggcaataacattgttaagaacttttacagaa
aaagggggtattgcccttaattacacagagcttaaaaaattcagaaaggaaaatggaaag
ctttcgggtgttatcatacaaaataaattgtcaaaagaacaaatttcactaaaaagtaaa
tgcgtaataaacgcaacaggaatattctcagatcaaataagaagattagatgatgaaaaa
actttaaatattataaaaccttctcaaggtagccatttaataatcaaaaaagataaattc
ccacaaaatcacgcaatattaatgcctaaaactagtgataataggattttatttgctatt
ccttggtatggtagtgttgtttgcggaagtaccgacatctcaataaaagaaatagaagaa
gagcctaaaagacttgatgaagagattgactttataataaataatttaaacaattattta
aatattaaaatagaaaaatcagacataaaaagcgtttatacaggaataagaccattaata
attgatccaaaagctgggggcaacacttccaaaatttcaagaaatgaaaaaatatttata
tcagattcaaatcttattacaatagcagggggtaaatatactacatatagaaaaatggca
gaaaaaaccttgcttaaagccatagaaaacgatttaataccaaattacccaccaactaca
gaagatttaaagttacacggttatcttaaaaaagaagaggcaataaaaattcctgaagct
tttagagcttacggaagtgattttgaaattctaaaaaatatggaaggatttgataagaat
attcacgagaatttagatttaaatgaagctcaaataactttttcaattaaatttgaacaa
gccaaaaccattgacgatgttctagcaagaagaacaagatcgctacctttaaatcctcaa
gctacaattgaagctgctccaaaagttgctgaaataatgatgaaaaaactaaacaaatct
gaagagtggaaaaatgaacaaataaaaagcttcttagaaataagtaaaaaatatttaatt
taa

DBGET integrated database retrieval system