KEGG   Bifidobacterium choerinum: BcFMB_08525Help
Entry
BcFMB_08525       CDS       T05748                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
bcho  Bifidobacterium choerinum
Brite
KEGG Orthology (KO) [BR:bcho00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bcho01001]
    BcFMB_08525
Enzymes [BR:bcho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BcFMB_08525
Protein kinases [BR:bcho01001]
 Serine/threonine kinases: Other
  Bacterial family
   BcFMB_08525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Pkinase_fungal Kinase-like Haspin_kinase ABC1 Kdo
Motif
Other DBs
NCBI-ProteinID: ATU20955
UniProt: A0A2D3D772
LinkDB All DBs
Position
2092252..2094390
Genome map
AA seq 712 aa AA seqDB search
MSEAQDMPKDRLVDGRYRIVRKIADGGMATVYQAVDVRLGRDVAIKIMHQQLAQGPYREQ
FIARFHREANAAASIASPYIVQVYDSGEHDGLDYLVMEYVKGVNLRAEMQHKRTFSVRET
LRVVSETLSGLAAAHAARVVHRDIKPENILINNRGRVQITDFGLAKAISQATLSSTGMLL
GTAAYLAPEMISDNEALPQGDCYSVGIMAWEMLAGRVPFQTDNPVTMVFKHVNENVPSIA
TVCAGIDPRVARFISSLTNRDVADRPADASVALDRLQELMRTLPPEALRYRYDPSAQPQP
TTAMSAVAANAANAANSTDIAHDPNAAGRPAPAQPMERMQSGTAPRGNDDPTSTIARPPQ
TPSDGRPPMSGSSAAPFAGDDSPTAMQPQRKSHVGLIVGIVAAIVAVLAAGGTWAWWYYA
GPGSYNTMPKPEGLECEQNAPCRITGVDWKSYESALNVSDIHYEVSRAHSDDVPEGDVIS
TDPAYVDAHVSKRHEQTVKVVVSLGIQQVTIPKDIKSSDDPLAALKRAGIEHIEHSDDTD
EWSLDVPQGMVISITPEPGTTIAHNETVDVVLSKGPMPVQMPDLIGQTKDYAQKTLEEDK
LEVTFEEEFSDSVPVGQVLYTSQDAGSTLHWGDAVTVTVSKGPETVKMPDVVGKSPEDAR
KELEALGLKVKIDKPLGVDVLHRVQGQDPKAGSDVPKRTKDGDPTTVTIRIV
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagcgcaggatatgcccaaggacaggctcgtcgacggtcgctaccgcatcgtg
cgcaagatcgcggacggcggcatggccaccgtctaccaggcggtggacgtcaggctcggc
cgcgacgtcgcgatcaagatcatgcaccagcagctcgcgcagggaccgtaccgcgagcag
ttcatcgcgaggttccaccgcgaggcgaacgcggcggcctcgatcgcgagcccctacatc
gtgcaggtctacgactccggcgagcacgacggcctcgactacctcgtcatggaatacgtc
aagggcgtcaacctgcgcgccgagatgcagcacaagcgcacgttcagcgtgcgcgagacg
ctgcgcgtcgtctccgagacgctcagcggcctcgcggcggcgcacgcggcgcgcgtcgtg
caccgcgacatcaagcccgagaacatcctaatcaacaaccgcggacgcgtccaaatcacc
gacttcgggctcgcgaaggcgatctcgcaggccacgctctcgtcgaccggcatgctgctg
ggcacggccgcctacctcgcgccggagatgatcagcgacaacgaggcgctgccgcagggc
gactgctattcggtcggcatcatggcctgggagatgctcgccggacgagtgccgttccag
accgacaacccggtgacgatggtcttcaaacacgtcaacgagaacgtgccgtcgatcgcg
accgtgtgcgccggcatcgacccgcgcgtcgcacgcttcatctcgagcctgacgaaccgc
gacgtggccgaccgtccggccgacgcgtcggtcgcgctcgaccggctccaggagctcatg
cgcacgctgcctccagaggcgctgcgctaccgctacgacccgtcggcgcagccgcagccg
acgacggcgatgtcggccgtcgcggcgaacgcggcgaatgccgcgaacagtacggacatc
gcgcacgatccgaacgccgcaggacggcccgcgcccgcacagccgatggagcgtatgcag
agcggcacggcgccgcgcggcaacgacgacccgacgagcacgattgcgcgacctccgcag
acgccgtcggacggccgtccaccgatgtccggctcctccgccgcgccgttcgccggcgac
gacagtccgacggcgatgcagccgcagcgcaagagccatgtcgggctcatcgtcggcatc
gtcgccgcgatcgtcgccgtgctcgccgccggcggcacctgggcatggtggtactacgcg
ggccccggcagctacaacacgatgccgaagccggaggggctcgaatgcgagcagaacgcg
ccgtgcaggatcaccggcgtcgactggaagagctatgaaagcgcactcaatgtctcggac
atccactacgaggtgagccgcgcccacagcgacgacgtgccggagggcgacgtcatctcc
accgacccggcctacgtcgacgcgcatgtgagcaaacgtcacgagcagacggtcaaagtc
gtcgtctcgctcggcatccagcaggtgacgatccccaaggacatcaagtcgtccgacgac
ccgctcgccgcgctcaagcgcgccggcatcgaacacatcgagcattcggacgacaccgac
gaatggtcgctcgacgtgccgcagggcatggtcatcagcatcacgccggagccgggcacg
acgatcgcgcacaacgagaccgtcgacgtcgtattgtcgaagggtccgatgccggtgcag
atgcccgacctgatcggccagacgaaggactacgcgcagaagacgctcgaggaggacaag
ctcgaggtcacgttcgaggaggagttcagcgacagcgtccccgtcggtcaggtgctctac
acctcgcaggacgccggttcgacgctgcactggggcgatgcggtcacggtgacggtctcg
aaggggccggagacggtgaagatgccggacgtcgtcggcaagtcgccggaggacgcgcgt
aaggagctcgaggcgctcggcctcaaggtcaagatcgacaagccgctcggcgtggacgtg
ctgcaccgcgtgcagggccaggatccgaaggccggctccgacgtgcccaagcgcacgaag
gacggcgatccgacgacggtgacgatccgcatcgtctga

DBGET integrated database retrieval system