KEGG   Candidatus Baumannia cicadellinicola BGSS: IM45_1401Help
Entry
IM45_1401         CDS       T03277                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
bcib  Candidatus Baumannia cicadellinicola BGSS
Pathway
bcib00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bcib00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    IM45_1401
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bcib01002]
    IM45_1401
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bcib01011]
    IM45_1401
Enzymes [BR:bcib01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     IM45_1401
   3.4.21  Serine endopeptidases
    3.4.21.-  
     IM45_1401
Peptidases and inhibitors [BR:bcib01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   IM45_1401
Peptidoglycan biosynthesis and degradation proteins [BR:bcib01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   IM45_1401
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AIN47561
UniProt: A0A088N2J8
LinkDB All DBs
Position
743351..744790
Genome map
AA seq 479 aa AA seqDB search
MFVSKLIRCWTSVLILSAQAVAVENYTAYLPEGVNLALMVQKVGAPQPIIDYHSQQLALP
ASTIKLLTALAALLQLGPTYRFHTSFEAVLPAVEGVLHSDLIAHFGGDPTFSRQRLHTMV
TTLRKQRIRQITGNLIIDTSVFASYDKAPGWPWNNLTRCFSSPPGAAIIDRNCFSLSLYS
GQTVGEIAFIHLSSYYPIHMFSQVRTLARRSRDYCELDIISGELNRFTLTGCITQRSEPL
SLTFAVQDGASYVGAIIKEALKQADIKLNGTIIRQNYPTTVTSRQVLAESTSAPLHDLLH
VMLKTSDNMIADTIFRTIGHERFKVPGTWRAGSDAVRQILHEYANINLGNTIQVDGSGLS
RYDLISPATMMRVLQYIGQHDQVLNFISMLPLAGYDGTLMFRTGLHKAGLDGKLSAKTGS
LQGVYNLAGFMTVSSGQRIAFVQYLSGYTVLHSPEDSYAYKIPLVRFEYWLYKTIYLHN
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtttcaaaattaataagatgctggactagtgttttaatactatccgcacaagca
gtagcggttgaaaactacaccgcatatttaccagaaggtgttaacctagcgttaatggta
caaaaagtaggagcgccgcagccgattatcgattatcacagtcagcagctagcgctacct
gctagtacgattaagctattgacagcactagcagcactactacaactaggaccaacctat
cgttttcatactagttttgaagcagtattacctgctgtagagggagtattgcacagtgat
ctgatcgcacattttggcggtgatccaacattttctcgtcaacgactgcatacaatggtg
acaacactacgtaagcagcgtataagacagattactggtaacttaattatcgatacgtca
gtattcgctagttatgataaagcacctggttggccatggaataatttgacccgatgcttt
agttcacctccaggtgctgcgatcattgatcgtaactgcttttctctttctctttatagc
gggcagactgtaggtgaaatagcttttattcatctctcttcttactatcctatacatatg
ttcagtcaggtacgtactcttgcgcgtagatctcgagattactgtgagctagatataata
tcaggcgaactaaatcgttttaccttaacaggttgtattactcaacgctctgaacctcta
tcacttacatttgcagtacaggatggcgctagctatgtcggtgccattataaaagaagca
ctaaagcaggcagatataaagctgaatggtacgattatacgacaaaattatcctactaca
gttacatcacgtcaggttttagcggaatctacttctgcgccattacatgatttattacat
gttatgctcaaaacatcagataatatgattgccgatactatttttcgtaccatcggccat
gaacgcttcaaagtaccgggcacctggcgtgctggttctgacgcagtacgccaaattcta
cacgaatatgctaatattaacttaggtaacactattcaagttgatggatctggtctatca
cgctatgatctcatctcgcctgcaactatgatgcgtgtcctacaatatatcggtcagcat
gatcaggtactcaatttcatctctatgctaccattagctggttatgacggtacgctgatg
tttcgtactggcctgcataaagcaggattagacggtaaactttcagcaaaaactggctca
ttacaaggtgtctataatttagctggttttatgacggtctctagtggtcagcgtatagcg
tttgtccagtatctttctggatatacagttttgcattcaccggaagattcgtatgcatat
aaaataccgttagttcgttttgaatactggctatataaaactatttatcttcataactaa

DBGET integrated database retrieval system