KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_048
Entry
AB162_048         CDS       T04544                                 

Gene name
ligA
Definition
(GenBank) DNA ligase
  KO
K01972  DNA ligase (NAD+) [EC:6.5.1.2]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03410  Base excision repair
bcig03420  Nucleotide excision repair
bcig03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_048 (ligA)
   03410 Base excision repair
    AB162_048 (ligA)
   03420 Nucleotide excision repair
    AB162_048 (ligA)
   03430 Mismatch repair
    AB162_048 (ligA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_048 (ligA)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_048 (ligA)
Enzymes [BR:bcig01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.2  DNA ligase (NAD+)
     AB162_048 (ligA)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     AB162_048 (ligA)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA ligase
     AB162_048 (ligA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AB162_048 (ligA)
   MMR (mismatch excision repair)
    DNA ligase
     AB162_048 (ligA)
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AB162_048 (ligA)
SSDB
Motif
Pfam: DNA_ligase_aden DNA_ligase_OB HHH_2 HHH_5 DNA_ligase_ZBD RNA_pol_A_CTD OrfB_Zn_ribbon
Other DBs
NCBI-ProteinID: AKZ65676
UniProt: A0A0K2BJT2
LinkDB
Position
complement(61952..63709)
AA seq 585 aa
MENIEQKIKKLREQLRDWDLFYYVENFPKVSDVEYDVVMMQLRELETQYPELITADSPTQ
SVGGKVQNSFSKVRHKVPMLSLDHIFEDDSLLAFDTRVREKLKYYDSINYCCELKLDGLA
VSLLYKNGELILAATRGDGTIGENVTKNVRTIPTIPLRLKDDGNIPNLIEIRGEIVMSKA
NFLRINETAKKEKGKVFANPRNAAAGSLRQIDPTITANRSLNCFCYGVGLIDKETLPTSH
WELLQQFKKWGLPVSNIICLCTGYNEIIKFYRHIHNTRHLLDFNIDGIVIKVDSLLQQQQ
LGFITRAPRWAIAYKLPAKEKLTIVKNVEFTVSRNGTITPVARLEPVLFSGTSVSNASLH
NLNEIKRLGLMIGDTVVIRRAGHVIPQIVNIVMAQRYTKKTSPIIFPKLCPVCGSKLEKE
KNTISCIAGLVCDAQRKEKLKHFISRKALNVNGIGNKIIDQLVDRQLVQTTADLFRLNQD
KLTSLDRIGHKSAQKLLDALESAKRTTFARFIYALGIREVGETKAAYLADYYINISSLMV
ADITSLINVKDIGIIVATNVRNFFNQQDNIAVINDLLSPQIGLKW
NT seq 1758 nt   +upstreamnt  +downstreamnt
atggaaaatatagaacaaaaaattaaaaaattacgtgaacagctgcgtgattgggattta
ttctattacgtagaaaattttccaaaagtatctgatgtagaatatgacgttgtcatgatg
caactaagagaactagaaacacaatatcctgagctaattacagctgactctcctacacaa
agcgtaggaggaaaagtacaaaatagctttagtaaggtacgccacaaagttcctatgcta
tcattagatcatatattcgaagatgatagtttattagcttttgatacaagagtacgtgag
aaactaaagtattatgattctattaactattgctgtgaactgaaactcgacggattagcg
gtaagtttactttataaaaatggtgagctaatactagcagctactcgtggtgacggaact
ataggtgagaatgtcacaaaaaatgtacgtaccataccaacaattccgttacggttgaaa
gatgatggtaatataccaaatttaattgaaattcgcggcgaaattgttatgtcaaaagct
aattttctgcggattaatgaaactgcaaaaaaagaaaaaggtaaagtttttgctaatccg
cgcaatgcagcagcaggatctttgcggcaaatagatcctactattactgcaaatagatca
ctaaattgtttttgttatggagtaggactaatagataaagaaacattacctacaagtcat
tgggaactactacaacaatttaaaaaatggggcttacctgttagtaacattatttgccta
tgtacaggttacaatgaaattataaaattttatcgccatatacataacactaggcattta
cttgattttaacatcgacgggattgtcattaaggttgattctttattacagcagcagcag
cttggttttataactcgcgcaccaagatgggctattgcttataaattacctgctaaagaa
aaactaaccatagtaaaaaatgtagaatttacagttagccgaaatggtacaattacgcca
gtagcacgtttagaaccagttttgttttcaggtactagcgttagtaacgctagtttgcat
aatttaaatgaaattaagcgccttggattaatgataggtgatacggtagtgattcgtcgc
gctggtcatgttataccacagattgttaatatagtaatggcacaaagatatacaaaaaaa
actagtccaataatatttcccaagctatgtccagtatgcggatcaaaattagagaaagaa
aaaaatactattagttgtattgcaggtttagtatgcgatgcgcaacgtaaagagaaactt
aaacactttatttctcgcaaggctcttaatgttaacggtataggaaataaaatcattgat
caactagttgatcgtcaactagtacaaactactgctgatttatttagattaaatcaagat
aaattaactagtttagatcgtatagggcataaatcagcacaaaaattgctagatgcacta
gagagtgcgaaaaggacgactttcgctcgttttatttatgcactgggtattcgtgaagtt
ggagaaacaaaagctgcatatctagcagattattatataaatattagttctttgatggta
gctgatattacatcactaattaatgttaaggatataggaataattgttgctacaaatgta
agaaatttttttaatcaacaagataatattgctgtaattaatgatttattaagcccacag
attgggcttaaatggtaa

DBGET integrated database retrieval system