KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_086
Entry
AB162_086         CDS       T04544                                 

Gene name
ssB
Definition
(GenBank) Single-stranded DNA-binding protein
  KO
K03111  single-strand DNA-binding protein
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_086 (ssB)
   03430 Mismatch repair
    AB162_086 (ssB)
   03440 Homologous recombination
    AB162_086 (ssB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_086 (ssB)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_086 (ssB)
   03029 Mitochondrial biogenesis [BR:bcig03029]
    AB162_086 (ssB)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    AB162_086 (ssB)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     AB162_086 (ssB)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AB162_086 (ssB)
Mitochondrial biogenesis [BR:bcig03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    AB162_086 (ssB)
SSDB
Motif
Pfam: SSB
Other DBs
NCBI-ProteinID: AKZ65707
UniProt: A0A0K2BKH5
LinkDB
Position
complement(96625..97089)
AA seq 154 aa
MANRGVNKVILVGHLGHNPEIRYMPNGCAVANINVATSDIWRDKHTGDTKEKTEWHRVVL
FGKLAEVTGEYLRKGAQVYIEGSLQTRKWQDKNGQDRYTTEIVVNAGGTMQMLGSRNHTD
SSNTMTNNSNNFDIEQKKNTEHETPIDFDDDIPF
NT seq 465 nt   +upstreamnt  +downstreamnt
atggctaacagaggcgttaataaagtgattctagtaggacatttaggtcataatccagaa
atacgctatatgcctaatggttgtgctgttgctaatataaacgtagctacatcagacatt
tggcgtgataagcatacaggcgacaccaaagagaaaactgagtggcatagagtagtactt
tttggtaaactagcagaagttactggggaatacctacgtaaaggcgctcaagtatatata
gaaggttcgttacaaacacgtaagtggcaagataaaaatggtcaagatcgctacactact
gaaatagtagtaaatgcaggtggtactatgcaaatgctaggtagtcgtaaccatactgat
agtagtaatactatgactaataatagtaataattttgatatagaacaaaaaaaaaatact
gaacatgaaactccaatagactttgatgatgatattcctttctaa

DBGET integrated database retrieval system