KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_090
Entry
AB162_090         CDS       T04544                                 

Gene name
recG
Definition
(GenBank) ATP-dependent DNA helicase RecG
  KO
K03655  ATP-dependent DNA helicase RecG [EC:3.6.4.12]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_090 (recG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_090 (recG)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AB162_090 (recG)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AB162_090 (recG)
SSDB
Motif
Pfam: Helicase_C RecG_wedge DEAD ResIII tRNA_anti-codon SecA_DEAD AAA_30 SNF2_N IMS_HHH DUF2075 RC-P840_PscD PhoH DUF2791
Other DBs
NCBI-ProteinID: AKZ65711
UniProt: A0A0K2BJW6
LinkDB
Position
101272..103374
AA seq 700 aa
MTGYCKLRTIPINKLSGVGPKLIAKLAKLGLDNLQDVLLHLPISYEDRTKLYPIINAPNG
MLVTIQGKILDNKIYITLSNKHILSCRLQDNSGVITLLFFNFNISIKKSLSPGKLVIAYG
EINRSKIGVNMINPKYYIQDDKCRIILNQSLTPIYLTTAGLGQDKLRYITEKALNVLATT
QVAELLPPKLSSELISLSDALHKLHRPPTNISITELESFRHTAQKRLILEELIAYDLSIL
AARKVVQESIALPLSNHTYLINRFISSLPFSLTAAQKRVIADIYQDLESNIPMMRLVQGD
VGSGKTLVAALAALRAISNNSQVAMMTPTELLAEQHLHNFSNWFTPLGIHVSWLTGKQQL
KIRNSQLEAIASGNVAMIIGTHAIFQKQVKFAKLALVIIDEQQRFGVNQRLNLWKKGIKN
GIKPHQLIMTATPIPRTLAMTANVNINTSVLNELPPGRTPVTTIVVANNRRVEIIKRLKQ
ACLQDKRQVYWVCTIINKSEFNDLHSVKDTLDELRIALPELNIGLVHGRMEANEKKYYLN
LFQSGKIQLLVSTTVIEVGIDVPNASMIIIDNPERLGLAQLHQLRGRVGRGAVNSHCVMI
YKPPLSEKSKLKLKALRDSSDGFTIAKHDLKIRGYGQFFGTRQTGKNQFRFAELPRDKEI
ISEVQPIVHDIHTNFPNIAQALIQRWMPQNNNFTYHYTYA
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgaccggatattgtaaattaaggactataccaataaacaaactatccggagtaggtcca
aaattaatagctaaattagctaagttaggactagataatttacaagatgtacttttgcat
ttacctatcagttatgaagatagaactaaactttatcctattatcaatgcaccgaatggt
atgttagtaacaatacaaggtaaaatattagataataagatttatattaccttaagcaat
aaacatatactgagctgtcgtttgcaagataatagtggtgtaattacactattatttttc
aattttaatatatcaattaaaaaaagtttatctcctggaaaattggtaatcgcctacggc
gaaataaatagaagtaaaattggagttaatatgattaatcctaaatactatatacaagat
gataaatgtagaattatattgaatcaatcacttaccccaatatatcttactactgcagga
ttaggtcaggataaattacgttatattactgagaaagcgctgaatgtactagctactaca
caagtagcagaattattaccacctaagttaagtagtgaattaatcagcttatcagatgcg
ttacataagctacatagaccaccgactaatatttcaataacagagttagaaagttttcgt
catactgcacaaaaaaggctaattttagaagaattaatagcttatgatttaagtatatta
gcagcaagaaaagtagtacaagaatccatagcattaccattaagtaatcacacatatctg
ataaatcgttttatttcatcgttaccattttcacttactgctgctcaaaaaagagttata
gcagatatttatcaagatctagaaagtaatattcctatgatgcgattagtacaaggagat
gtaggttctggcaaaacactggtagcagcgctagctgcattacgtgctattagtaataac
agtcaagtggcaatgatgacgccaactgagctactagctgaacagcatttgcataatttt
agtaattggtttaccccattgggtattcatgtaagttggcttactggtaaacagcaatta
aaaataagaaattcgcagctagaagctatagcatctggtaatgtagcaatgattattgga
actcatgctatatttcagaaacaagtaaaatttgctaaacttgcgctagtaattattgat
gaacagcaaagatttggtgtaaatcaaagactaaatttatggaaaaaaggaataaaaaat
ggcattaaaccgcaccaattaattatgacagcaacgccgatcccacgtacattagctatg
acagctaatgtcaatataaatacttcagttctgaatgaactacccccaggacgtacccct
gttactacgattgtagtagcaaataatcgtcgtgtagaaattataaaacgtttgaaacaa
gcatgtttacaagataaacgtcaagtttattgggtatgtaccataattaataaatcagaa
tttaatgatttacattcagtaaaagatactttggatgaattacgtattgctctgcctgaa
ttaaatataggtttagtacatggacgtatggaagcaaatgaaaaaaaatattatttaaat
ttatttcaaagtggaaaaatacaattactagtatcgaccacagtaatagaagtcggtata
gatgttccaaatgctagtatgattattattgataatccagaacgtctgggtttagcgcaa
ttacatcagctacgcggtcgagtaggtcgtggcgctgttaattctcattgcgttatgatt
tataaacccccgctaagtgaaaaatctaagttaaaacttaaggcactaagagatagctca
gatggttttactattgctaaacatgatctcaaaataagaggttatggtcaattttttgga
actcgtcagacaggtaaaaatcaatttagattcgcagaactacctagagataaagagata
atatcagaagtacaacctatagtacatgatattcataccaactttcctaatatagcacag
gcactaattcaacgttggatgccgcaaaataataattttacttatcattatacatatgca
taa

DBGET integrated database retrieval system