KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_092
Entry
AB162_092         CDS       T04544                                 

Gene name
polA
Definition
(GenBank) DNA polymerase I
  KO
K02335  DNA polymerase I [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03410  Base excision repair
bcig03420  Nucleotide excision repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_092 (polA)
   03410 Base excision repair
    AB162_092 (polA)
   03420 Nucleotide excision repair
    AB162_092 (polA)
   03440 Homologous recombination
    AB162_092 (polA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_092 (polA)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_092 (polA)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_092 (polA)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    Other elongation factors
     AB162_092 (polA)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA polymerase I
     AB162_092 (polA)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AB162_092 (polA)
SSDB
Motif
Pfam: DNA_pol_A 5_3_exonuc_N 5_3_exonuc DNA_pol_A_exo1 XPG_N
Other DBs
NCBI-ProteinID: AKZ65713
UniProt: A0A0K2BKY8
LinkDB
Position
complement(104101..106863)
AA seq 920 aa
MVNNNLLLIDGSFYLYRAYHAFPQLTNKYGEPTGAIYGMINMLNKLLLQYHTNKIAVIFD
DQSLTFRHKLYKDYKKNRTIMPHNLYCQINPLYEIIKAMGLPILMVQGVESDDVIGTLAK
EAAYSGSNVLISTGDKDMAQLVSNQINLINTISNTILGPKEVKHKFGVPPELIIDYLALM
GDKSDNIPGVPGIGKKTAKVLINKLGGINILFNNLNQIINLSLRGKRNIVAKLEQNRDIA
FLSYKLATINTNVKLDINYHQLMLKEHNYEKLILLFKIYEFNLLMLQLKLGKWRWLKKTA
TTVVINSSNPMLIKHHCELTEKLSKQYYKVIYQITELKQLIADIRSAGFFSFDITTDVKD
IYTANLVGFCFAISSGKAAYLPVGHNYCNAPNQLSVAQVLYFIKKIFEDVTIVKIGYNLK
FNYLILKFNNINLAGSIFDIMLESYVLNSVSCKHNIESLANYYLNYNTVRLNTILGIGRN
KLKFNKISIQIAANYANEYTDIMLRLHNLLWPCIEAIPDLKKIFNIIEIPLLLVLARIES
TGVMIDENLLANYSIDVNHRLYELKVAAYKLAKEYFNISSTKQLITILYDKHKLPVLKKT
PSGVPSTNEEVLRALAKEYKLPKIILDYRCLAKLKSNYLDKLPLLINQKSKRLHTSYNQE
KTATGRLSSSSPNLQNIPVRYEVGRLIRRAFIAQPNFFIVVADYSQIELRILAHLSRDMC
LSHAFYIGQDIHLATAAEIFNISIDDVTTDQRSRAKTINFGLIYGMSSFGLARKLSVPIS
EAEKYIKFYFARYPYVRQYMDTVVQQAKEQGYVSTIYGRRLYLPEINKKSTERAAINAPM
QGTSADIIKIAMIAIDKWLQQEAPQVCMIMQVHDELVFEVHKNIIISATNSIRKIMEGCV
SLDIPLKVDIRVGKNWDEVS
NT seq 2763 nt   +upstreamnt  +downstreamnt
atggtaaacaataatttacttttaatcgatggttcattctatctttaccgtgcttatcat
gcttttccacagctaactaataaatatggtgaacctactggtgcaatttacggtatgata
aatatgttaaataaactattattacaataccatactaacaaaatagcagttatttttgat
gatcaaagtttaacatttcgtcataaattatataaagattataaaaaaaaccgtactata
atgccacataatctatattgtcagattaaccctttatatgaaattattaaagctatggga
ttaccaatacttatggtgcaaggtgtagaatctgatgatgtgattggcaccttagcgaag
gaagctgcgtactctggtagtaatgttttaattagtactggcgacaaagatatggcacag
ttagtttcaaatcaaattaatttaattaacacaatatctaataccatcttaggacccaaa
gaagtaaaacataaatttggtgtaccaccagaattgatcattgattatttagcactaatg
ggcgataagtcagataatattcctggagttcctggtataggaaaaaaaacagctaaagta
ctaatcaacaagctaggtggaataaatatattatttaataatttaaatcaaattatcaat
ttaagcctacgtggtaaacgtaatatagtagctaaactggaacaaaatcgtgatatagca
tttctttcttataaattagctactattaatactaatgttaaactagatattaattatcat
caactaatgttaaaagaacataattatgaaaaactaattttactttttaagatttatgaa
tttaatctattgatgctccaattaaaattaggtaaatggcgatggctaaaaaaaacagcc
actacagtagttatcaattctagtaatcctatgcttattaagcaccactgtgaacttact
gaaaaactatcaaaacaatactataaagttatttatcaaattactgaattaaagcagttg
atagctgatattcgtagcgccggatttttttcattcgatatcacaacggatgtaaaagat
atttacacagctaacttagttggtttctgtttcgcaattagttctggtaaggctgcttac
ctaccggtaggacataattattgtaatgcaccaaatcaactaagtgttgcgcaagtacta
tattttattaaaaaaatttttgaagatgtcactatagtaaaaataggctataacttaaaa
tttaattacctaatattaaaatttaataatataaatttagctgggagtatatttgatatt
atgctagagtcctatgtgctcaatagtgtatcttgtaagcataatatagaaagtttagca
aattattatctaaattataatacagtgagattaaatacaatattaggaatagggcgtaat
aaactaaaatttaacaaaatttctatacaaatagcagcaaattatgctaacgaatatact
gatattatgttacgtttacataatcttctttggccatgcatagaagcaattcctgattta
aaaaaaatattcaacataatagaaatacctttattattagtactagcacgtattgagagt
actggcgttatgattgatgaaaatcttctagctaactactcaatagatgttaatcatcga
ttatatgaattaaaggtagctgcatataaactagcaaaagagtactttaatatatcttct
actaagcagctaatcactatattatatgataaacataaactaccggtacttaagaaaact
cctagcggtgtaccttctactaatgaagaggtacttagagctcttgctaaagaatataag
ttacctaaaataattttagattatcgctgcctagctaagctaaaatcaaattatcttgat
aagctaccgttactaattaatcaaaagtctaaaagattacatacatcttataatcaagaa
aaaactgctacaggacgtctttcttccagtagtcctaatctacagaacatcccagtacgc
tacgaagtaggtagattgattcgcagggcttttattgcacaaccaaatttttttattgtg
gtcgcagattattcacagattgaactacgaatactagcgcatttatctcgtgatatgtgc
ctgtcacatgcattttatattggacaagatattcatcttgctacagcagcagaaatattt
aacatatctatagatgatgtaactacagatcaacgtagtcgtgctaaaactattaacttt
ggactaatttatggtatgagttcttttggtctagcgagaaaattatctgtgcctatttca
gaagcagaaaagtatattaaattttactttgcccgatatccatatgtacggcagtatatg
gatactgttgttcaacaagctaaagaacaaggatatgtttctactatttacggtaggagg
ctatatctaccagaaatcaataaaaaaagtactgaacgtgctgcaattaatgctcctatg
caagggacatcagctgatattattaagatagcgatgatagctatagataaatggttacag
caagaagcaccacaggtttgtatgattatgcaggtacacgatgagcttgtatttgaagta
cataaaaatataataataagtgctactaatagtattagaaagattatggaaggttgtgtg
tcgcttgatatccctttaaaagtagatataagagtaggtaaaaactgggatgaagttagt
taa

DBGET integrated database retrieval system