KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_093
Entry
AB162_093         CDS       T04544                                 

Gene name
dnaX
Definition
(GenBank) DNA polymerase III subunits gamma and tau
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_093 (dnaX)
   03430 Mismatch repair
    AB162_093 (dnaX)
   03440 Homologous recombination
    AB162_093 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_093 (dnaX)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_093 (dnaX)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_093 (dnaX)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_093 (dnaX)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_093 (dnaX)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNA_pol3_gamma3 AAA RuvB_N AAA_5 AAA_22 AAA_14 TIP49 AAA_16 AAA_24 ResIII AAA_7 AAA_30 AAA_18 AAA_19 Mg_chelatase PIF1 TsaE DNA_pol3_delta ABC_tran DUF815 SKI Rad17 AAA_28 AAA_2 Sigma54_activat CbiA VirE
Other DBs
NCBI-ProteinID: AKZ65714
UniProt: A0A0K2BKJ9
LinkDB
Position
107133..108275
AA seq 380 aa
MSYQVLARKWRPQNFSEVVGQEHVITALTNSLVLGRIHHSYLLSGTRGVGKTTIARLLAK
CLNCEKGITTIPCSECKSCREITNNCFVDFIEIDAASSSKVEDTREILDHIQYVPTNGRF
KIYLIDEVHMLSRHSFNALLKTLEEPLAHIKFLLATTDPQKIPLTILSRCLQFHLTTLNI
NQICNQLSKILTAEKINTEQRALKLIARAAYGSMRDALSITDKAIAIGQGIVSVEAVSVM
LGTINTEQSLALIEALVNKNGSNMMKQLAKCAELGINWDNLLVDILSILHRIALAQIVPE
TKYYDDYLNNKLIPNILNLTKMISPEDIQLFYQIILIGRKELPYAPDQRMGVEMTMLRAL
AFHPVSINQTSFSAAYINNN
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgagctatcaggtacttgcacgtaagtggcgtccacaaaacttttctgaagtcgtcggt
caagaacatgttattactgcgctgactaatagtttggtgttaggaagaattcatcattca
tatctattatctggtactcgcggagtaggtaaaacaactattgcacgcttactagctaaa
tgtttaaattgtgaaaaagggataactactattccatgtagtgagtgtaaaagttgccgt
gaaattacaaataattgttttgttgatttcattgagatagatgctgcctcaagcagcaag
gtagaagatactcgtgaaattttagatcatatacagtatgtccccacaaacggtcgtttc
aaaatatacctaatcgacgaagtacatatgttatctagacatagttttaatgcgctgcta
aaaactctagaagagcctcttgcacatattaaatttctgctagctactactgatccacaa
aagatacctcttactattttgtcaagatgtctacaatttcatctaactactcttaatatt
aaccaaatatgtaaccagttaagtaaaatattaactgctgaaaaaattaataccgaacag
cgtgcattaaaactaatagcacgtgcagcatatggtagtatgcgtgatgcactaagtatt
actgataaagctattgctattggtcaagggatagtaagtgtagaagctgttagtgtaatg
cttggtactattaatacagaacaatcattagcattaatagaagcattagtaaataaaaat
ggttcaaatatgatgaaacagctagctaaatgtgcagaactaggtattaactgggacaat
ttattagtcgatatattatctattctacatcgtattgctttagctcagatagtccctgag
acaaaatactatgatgattatcttaataataaacttatacctaatatacttaatttaaca
aaaatgatttcaccagaagatatacaactattttatcaaattattctaattggtcgcaaa
gaactaccttatgcgccagatcagcgaatgggggtagaaatgactatgttgcgtgcgcta
gcttttcaccctgtatcaataaaccaaacatcattttcggctgcatatatcaataataat
tga

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_110
Entry
AB162_110         CDS       T04544                                 

Gene name
dnaN
Definition
(GenBank) DNA polymerase III beta subunit
  KO
K02338  DNA polymerase III subunit beta [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_110 (dnaN)
   03430 Mismatch repair
    AB162_110 (dnaN)
   03440 Homologous recombination
    AB162_110 (dnaN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_110 (dnaN)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_110 (dnaN)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_110 (dnaN)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_110 (dnaN)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_110 (dnaN)
SSDB
Motif
Pfam: DNA_pol3_beta_2 DNA_pol3_beta DNA_pol3_beta_3 BTB
Other DBs
NCBI-ProteinID: AKZ65729
UniProt: A0A0K2BKL4
LinkDB
Position
complement(126804..127910)
AA seq 368 aa
MKFIIERKNLLKPLQQVSSRLSGRNHLPILGNILVHVTEQYLFLTGTNLNIEILVRILIT
KVDELGITTVCARKFFDICRLLPESAQLSIKLENNIILISSGSSRFYLQTIAANNFPKIS
NWNSKVEFILQQKTLKHLMEATQFSMANQDVRYYLNGLLFETEGNKIRTVATDGYRISIC
TILVMNLVSLPYCSVILPRNSVIELLRIIDDNNNEVIFKIGSNNIKIYIGDYIITSKIID
GQFPNFNHIFTKKTNKTMQVSCKLLKQALTRVAILSHDKFHSVTFNMYNNKLKITTNNIE
KEEAEEILDVLYQDEEFEISFNINYILDVLKVLQCNKVFFKFSDKISCVKIEDCINNMSV
YFVMPIQL
NT seq 1107 nt   +upstreamnt  +downstreamnt
atgaaatttattattgaaagaaaaaatttacttaaacctctacaacaagttagtagtaga
ttaagtgggcgtaatcatttacctattttaggtaatatacttgtgcatgttacagaacaa
tatctatttttaactggtacaaatttaaatatagaaatattagtaagaatattgataact
aaagttgatgaactaggtattactacagtatgtgcacgtaaattttttgatatttgtcgt
ttgctaccagaaagcgcccagttatcaataaagttagaaaataatataatactgattagt
tcaggtagtagcagattttatcttcaaacaatagcagctaataattttcctaaaataagt
aattggaatagtaaagtagaatttatacttcaacaaaaaacattaaaacatttaatggaa
gctacacaattctctatggctaatcaggatgttcgctattatctaaatggtttattattt
gaaacagaaggaaataaaatacgtacagttgctactgatggatatcggatatctatatgt
actattttagtaatgaacttagtttctttaccttattgttctgtaatattaccacgtaat
agtgtaatagaattattaagaataatcgatgataataataatgaagtaatttttaaaatt
ggtagtaataatattaaaatttatattggtgactatattataacttctaagataattgat
ggacaatttccaaattttaatcatatttttactaaaaaaactaataaaactatgcaagta
tcttgtaagttgcttaaacaagctttaacacgtgttgctattttatcacacgataaattt
catagtgttacatttaatatgtataacaataaattaaaaattactacaaataatatagaa
aaagaagaggcagaagaaattttagatgtcttatatcaagatgaagaatttgaaattagc
tttaatattaattatattttagatgtacttaaagttttgcaatgtaataaagtttttttt
aaattttctgataaaatatcatgtgtaaaaattgaagattgtattaataatatgtcagtt
tattttgtaatgccaatccaattataa

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_195
Entry
AB162_195         CDS       T04544                                 

Gene name
holA
Definition
(GenBank) DNA polymerase III delta subunit
  KO
K02340  DNA polymerase III subunit delta [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_195 (holA)
   03430 Mismatch repair
    AB162_195 (holA)
   03440 Homologous recombination
    AB162_195 (holA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_195 (holA)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_195 (holA)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_195 (holA)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_195 (holA)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_195 (holA)
SSDB
Motif
Pfam: DNA_pol3_delt_C DNA_pol3_delta NUC
Other DBs
NCBI-ProteinID: AKZ65800
UniProt: A0A0K2BKF1
LinkDB
Position
213954..215015
AA seq 353 aa
MIRLYPSQLEVQLKTNLYSYYLLIGNDILLLQESQNSIYAKAHNLRFNEHYSIVLDEVTD
WDTIHSISKTRSLFASRQTLLLIIPEKGITAMIEEKLVAILGSLLNKDLLLILRSNKMFS
VNYNSKLLKVLSNYHGVLVNCTTPEPDKLPLWVHNRAKKMQLSLDNAACQLLCYCYEGNL
SALVNVLELLKLMYTDGILTLPRVEQSINDSSHFTIFNLINTILEGNHERASHIIHKLRL
VAIEPVILLRYIQQDVLLLLNISNKINDTPIRILFDQHKIWINRRPLLLKALKRINLQRL
YKAITLILKIELTIKNTNNDASDSDYIWANINNLALLLCCSNELIPAEMIEYI
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgattaggctatatccctctcagttagaagtacaactaaaaactaatttgtattcttac
tatttactgattggtaatgatatacttttgctgcaagagagccaaaatagtatttacgct
aaggcacataatcttaggtttaatgaacattatagcatagtgttagacgaagtcacagat
tgggatactatacatagtataagtaaaacacgaagcctattcgcaagtcgccaaacttta
ttattgataatacctgaaaaaggtatcactgcaatgatagaagaaaaattagtagctata
ttaggatctttattaaataaagatttattactaattttacgtagtaacaaaatgtttagt
gtgaattataatagtaaattgttaaaagtattaagtaactaccatggagtgttagttaac
tgcactacgcctgaacctgataaattgccattatgggttcataaccgtgcaaaaaaaatg
cagctatcgctagataatgctgcttgtcagttactatgttattgctatgaaggaaattta
tctgcattggtcaatgtactagagctcctcaagttaatgtacactgatggcatacttact
ctaccgcgggtagagcaatcaataaatgattcctctcactttactatttttaatttgata
aatactatactagaaggtaatcatgaacgtgctagtcatattatacacaagttacggtta
gtagctatagaaccagtgatactgctacgctacatccagcaagatgttttgctactactt
aatattagtaataagataaatgatacgcctataagaatattatttgaccaacataaaata
tggatcaatcgtagacctttacttctgaaggcgctaaagcggataaatttacagcgcttg
tataaagccataacactaattctaaagatagaactaactattaagaatacaaataatgat
gctagtgatagtgattatatatgggctaatattaataatttagcactgctattatgttgt
agtaatgagcttattcctgcagaaatgatagaatatatctaa

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_233
Entry
AB162_233         CDS       T04544                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_233 (holC)
   03430 Mismatch repair
    AB162_233 (holC)
   03440 Homologous recombination
    AB162_233 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_233 (holC)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_233 (holC)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_233 (holC)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_233 (holC)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_233 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi
Other DBs
NCBI-ProteinID: AKZ65834
UniProt: A0A0K2BKV8
LinkDB
Position
complement(255773..256216)
AA seq 147 aa
MKTATFYLINNNIKNELIAIERLACYLAILKWRAGKRILIACVHNKQARKLDDALWAYTP
TVFIPHNIVGEGPTDGAPVEICWPTRLSPVNSDLLISLLPTCAKFASFFNEVIDFIPNEE
SLKQLARTRYKVYRKVGFQLTITPPPQ
NT seq 444 nt   +upstreamnt  +downstreamnt
atgaaaacagcaactttctatcttataaataataatataaaaaacgagttaattgctatt
gagcgactagcttgttatctagctatcctaaagtggcgggccgggaaacgtatactaata
gcttgtgtacataataagcaagcaagaaaattagatgatgcgttatgggcatacactcct
actgtttttatcccgcataatattgttggtgaaggaccaacagatggtgcgccggtagaa
atatgttggcctactagacttagtccagtaaacagtgatctacttataagtctactgcct
acttgtgccaagtttgcttcatttttcaatgaagtaatagactttattcctaatgaagaa
tctctaaaacagttggcacgtactagatataaagtttatcgtaaagtaggctttcaatta
actattactccgccgccacaataa

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_379
Entry
AB162_379         CDS       T04544                                 

Gene name
holB
Definition
(GenBank) DNA polymerase III delta prime subunit
  KO
K02341  DNA polymerase III subunit delta' [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_379 (holB)
   03430 Mismatch repair
    AB162_379 (holB)
   03440 Homologous recombination
    AB162_379 (holB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_379 (holB)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_379 (holB)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_379 (holB)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_379 (holB)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_379 (holB)
SSDB
Motif
Pfam: DNA_pol3_delta2 DNApol3-delta_C AAA
Other DBs
NCBI-ProteinID: AKZ65970
UniProt: A0A0K2BKW2
LinkDB
Position
complement(391223..392227)
AA seq 334 aa
MIIYPWLESTYLNILNIYQQGKGYAILISSPPGNGKASLFKVIIRWLMCSIKPKSMKYCG
QCNSCQLMNTGNHPDYYYLNIKKERNSIGVDIIRMLIEKLYSHAYQDGAKLIWLAHIELL
TKQGMNALLKIIEEPPDNTYFLLGCRDYACILPTLLSRCIYWQLPLPIESMGLSWLHQQN
NDTYPILAARTALRLCGGAPLAAQYLLNSAYWEQRIELCSTISKVLHSGKFLTLLPLIDV
NDDAPLNWLLTILVDALKLQQSSQDFLVNLDQSALINAIAKRWTTIYLHDKVQQLLYCRK
KLSDIKGINRQLLLAHRLLNWELEISKYTYNNNI
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgataatatacccttggctagaatctacttacctaaacattttaaacatttaccaacag
ggtaagggatatgcgatattaatatctagtccaccaggtaacggcaaggcatctttattt
aaagttattattcgttggttaatgtgtagtattaagccaaagtcaatgaaatattgtggt
cagtgcaatagctgccagttaatgaatacaggtaatcacccagattattattatctcaat
ataaaaaaagaaagaaatagtattggagtagatataatacgcatgttgatagagaaatta
tattctcacgcgtaccaagatggagctaagttaatatggctagcgcatatagaattatta
actaagcaaggaatgaatgcactactaaaaattattgaggaaccgccagataatacttat
tttctacttgggtgtagagattatgcatgtattttaccaactttattaagccgctgtatt
tactggcagttacctttaccgatagaatctatggggttaagttggctacatcagcagaat
aatgatacttatcctatattagcagcacgcacagcgctacgtttatgtggtggtgctcct
ttagctgcgcaatatttattaaattcagcatactgggaacagagaatagaattatgcagc
acgattagcaaagttttacatagtggtaagtttttaactttgctacctttaattgatgtt
aatgatgatgcaccgctaaattggttactaactatattagttgatgcgctgaaactacag
caaagttcgcaagattttttagttaatttagatcaatctgctttaattaacgctatagct
aagcgttggactactatttatctacatgataaagtacaacaattgctatattgcagaaaa
aagttgtcagatattaaaggtattaatcgccaattactacttgcacatagattattaaat
tgggaattggagattagtaagtacacttataacaataatatataa

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_421
Entry
AB162_421         CDS       T04544                                 

Gene name
dnaQ
Definition
(GenBank) DNA polymerase III epsilon subunit
  KO
K02342  DNA polymerase III subunit epsilon [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_421 (dnaQ)
   03430 Mismatch repair
    AB162_421 (dnaQ)
   03440 Homologous recombination
    AB162_421 (dnaQ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_421 (dnaQ)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_421 (dnaQ)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_421 (dnaQ)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_421 (dnaQ)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_421 (dnaQ)
SSDB
Motif
Pfam: RNase_T DUF5051 DNA_pol_A_exo1
Other DBs
NCBI-ProteinID: AKZ66009
UniProt: A0A0K2BLD9
LinkDB
Position
complement(432986..433702)
AA seq 238 aa
METKIKRQVVLDTETTGMNKLGKPDEGHRIIEIGAVEIINRRITGNYFHVYLNPERLIDK
EAFAIHGISNIFLQDKPTFAEIADKFIKFISGSELIIHNAKFDISFIDNELIRLKSGMNN
LNYYCKVTDSLLLARKIFPGKRNSLDALCDRYLINKSNRIKHGALLDAEILAEIFLRMTG
GQMSINFNFEQNNKKINIKNINDQLLLKIIKANEQELIEHYSILKLIKKHSNKCLWII
NT seq 717 nt   +upstreamnt  +downstreamnt
atggaaactaaaattaaacgacaagttgttttagatactgaaactactggaatgaataag
ctaggaaaacctgatgaaggacacagaattattgaaattggtgccgtagaaattattaat
agacgtattactggtaattattttcatgtttatctaaacccagaaagattaatagataaa
gaagcttttgctattcacgggattagtaatatctttttacaagataaacctacctttgca
gaaatagcagataaatttattaaatttatttccggtagcgaattaattattcataatgca
aaatttgatattagctttatagataatgagctaataagactaaaaagtggtatgaataat
cttaattattattgcaaagttactgatagtctactacttgcacgaaaaatttttcctgga
aaacgtaatagccttgatgctttatgtgatcgttatttaataaataaaagtaacaggatt
aaacatggcgcactattagatgcggaaattttagcagaaatttttctgagaatgacaggt
ggtcaaatgtcaattaattttaattttgagcaaaacaataaaaaaatcaacataaaaaat
attaatgatcaattattattaaaaataattaaagctaatgagcaagaacttattgaacat
tattcgatattaaaattaataaaaaagcatagtaataaatgtttatggataatttaa

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_487
Entry
AB162_487         CDS       T04544                                 

Gene name
dnaE
Definition
(GenBank) DNA polymerase III alpha subunit
  KO
K02337  DNA polymerase III subunit alpha [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_487 (dnaE)
   03430 Mismatch repair
    AB162_487 (dnaE)
   03440 Homologous recombination
    AB162_487 (dnaE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_487 (dnaE)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_487 (dnaE)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_487 (dnaE)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_487 (dnaE)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_487 (dnaE)
SSDB
Motif
Pfam: DNA_pol3_alpha DNA_pol3_finger PHP HHH_6 tRNA_anti-codon tRNA_anti_2
Other DBs
NCBI-ProteinID: AKZ66070
UniProt: A0A0K2BL77
LinkDB
Position
505697..509188
AA seq 1163 aa
MTQPRFIHLRIHSDYSIIDGLIKVSTLVETAASMNMPALALTDCTNFFGIIKFYKSAYSV
GIKPIIGADLLIKSNTLGDELTELTILTTNNLGYHNLIMLISKAYKRGYGTDGPFIDRDW
LIKYNEGLIIISGARKGDLEQTLMRGQKIKFKQCLAFYQRYFKDRYYLGLIRTGRPEEEQ
YIKSSVELSNYYGLPVVANNDVRFIHNDDYHAHAIKVAIHEGSDLFSSKRKNNYSSQQYL
RSEQDMCELFADIPESLANSVEIARKCNVTIRLDEYFLPTFPISSNISIEDYLIKSATKG
LEDRLNFSFPDAMQRSNKKLYYNERLNKELKVINKMGFAGYFLIVMEFIKWSKDNNIPVG
PGRGSGSGSLVAYALNITDIDPLVFDLIFERFLNPERVSMPDFDIDFCMEKRDMVIDHVA
QTYGRDAVSQIITFGTMAAKAVIRDVGRVLGYPYPFINSLAKLVPNDIGIKLEQALILEP
ELQKLYILNEDVKVLIDIAKKLEGMTRNVGKHAGGVVISPTKITDFSPLYCDEQGNYPVT
QFDKNDVENAGLVKFDFLGLRTLTIINRTLKIINTRYVLNNINPINIQTIPLDDKKSFKM
LQSANTTAVFQLESKGMKELIKRLQPDCFEDIIALVALFRPGPLKSGMVDNFINRKHGRE
AICYPDINWQHKSLKPVLEPTYGIILYQEQVMQIARILAGYTLGEADILRRAMGKKNYAV
MVKQRAKFKAGAELLGINGELSMKIFNLLEKFAGYGFNKSHSAAYALVSYQTMWLKVHYP
AEFMAAAMTADIDNHEKIIIIINECLRMGIVVLPPDINKGQYHFHVNENREIIYGMGAIK
CLGKAQISSIIEERNKNGKFVDLFNLCKRIDIKKLNRRMLEKLILSGACDKLGPHRAAIM
KLLDLALKTADQSANSDSRGQIDIFGVNNIKNQVFFDQYLGPNFRPWSETVMLNGERETL
GIYLTGNPITQYLNEIKYYTGGVSLKDIHCLERGKQVTVVGLILSLKIKVTKQGNKICIC
TINYLNEHLDVIIFTPILQKYKNFLQKDTIVLVAGEVSVDNVTGSCQLIAINIMDINTAR
KKFSCGLAISLTKQQINKDFLKNISLTIKPHLSGIIPVHIYSKIENVRIRMRFGTNWQVM
PTDDLLNDLRLLVGHEQVQLEFD
NT seq 3492 nt   +upstreamnt  +downstreamnt
atgactcaaccacgttttattcacttacgtatacatagcgactattccattattgatgga
ttaataaaagttagtactttagtggaaacagcagcatctatgaatatgccagcattagct
ttaacagattgtactaatttttttggtatcattaaattttataaatcagcatatagtgta
ggaattaagccaattataggtgctgatttgttgataaaaagtaatacactaggtgatgaa
ctcactgaattaacaattctaactactaataacttaggctatcataatttaataatgctt
atctccaaagcatataagagaggctatggtacagatggcccttttatagatcgagattgg
cttataaaatataatgaaggtttaattattatttctggagcacgtaaaggtgatcttgaa
caaaccttaatgcgtggtcaaaaaattaaatttaaacagtgcttagctttctaccagcgc
tattttaaagatagatattatctaggacttattaggactggtagaccagaggaagaacaa
tatattaaatcttctgtagaactatctaattactatggattaccggtagtagcaaataat
gacgtacgttttattcataatgatgattatcatgcacatgccattaaagttgctatccat
gaaggctctgatttattttcttctaaaagaaaaaataactatagttcacaacagtatctt
cgaagcgaacaggatatgtgcgaattatttgcagatattccagaatcattagctaatagc
gtagaaatagctcgtaaatgtaatgtaactattagacttgatgaatattttttaccaaca
tttcctattagtagcaatatttctattgaggattatttaattaaatctgcaacaaaaggg
ttagaagatagactaaattttagttttccagatgctatgcagcgcagcaataagaaatta
tattataatgaacgtttaaataaagagctaaaagtaattaacaaaatgggatttgcaggc
tattttcttatagttatggaatttatcaaatggtctaaagacaataatatacctgtagga
ccaggcagaggatcaggatctggttctctagtagcctatgcacttaatataactgatatt
gatccgctagtttttgatctcatatttgagagatttctaaatcctgaacgtgtttctatg
ccagactttgatattgatttttgtatggaaaaaagagatatggtcattgaccatgtagca
caaacttacggtcgtgatgctgtatcacagattattacttttggtactatggctgcaaag
gctgtaatacgtgatgttggtagggtattaggttacccttatccatttattaatagttta
gctaaactagtacctaatgatattggaattaagctagaacaagctttaatactagaacct
gagctacagaagctatatatacttaatgaagatgtaaaggtattaatagatattgcgaaa
aaactagaaggtatgactcgtaatgtaggtaaacatgcaggtggagtagtaatttcgcca
actaaaattactgatttttctccgttatactgtgacgaacaaggtaattatccagttact
caattcgataagaatgatgtagaaaatgctggtttagtgaaatttgattttctaggatta
cgtactctaactatcataaacagaactttaaaaataataaatactaggtacgtgcttaat
aatatcaatcctattaatattcaaactattccattagatgataaaaaaagcttcaagatg
ttgcaaagtgcaaatactacggccgtatttcaactagaatcaaaaggaatgaaagaactt
attaaacgcctacaacccgactgtttcgaagatattatagcattagtagcattgtttcgt
cctggcccgctgaagtctggtatggtagataattttataaatcggaaacacgggcgtgaa
gctatttgttatccagatataaattggcaacacaaatctttaaagccggtattagaacct
acctatggcattattctttatcaggaacaagttatgcagatagctagaatactagcaggg
tatacacttggtgaagctgacatactacgacgcgctatgggaaaaaaaaattatgcagta
atggttaagcagagagcaaaatttaaggcaggcgcagagcttttaggtattaacggtgag
ttatctatgaaaatatttaatttattagaaaagttcgcaggatacggttttaataaatct
cactctgctgcttatgctctagtttcctaccaaactatgtggctaaaagtacactatcca
gcagaatttatggctgctgctatgactgcagatatagataatcatgaaaaaattattatt
attataaatgaatgcttacgtatgggtattgtagtattaccacctgatattaataaaggt
cagtatcattttcatgttaatgaaaatagagaaataatttatgggatgggtgcaataaaa
tgtttaggtaaagcacaaatttcttcaattattgaagaacgtaataaaaatggaaaattt
gttgatttatttaatttatgcaaacgtatagatataaaaaaactaaaccgacgtatgcta
gaaaagctgatattgtctggcgcttgcgataaactaggaccgcatcgtgctgcaattatg
aaattattagatctagcattaaaaacagctgatcaatctgctaactcagatagcagaggt
cagatagatatctttggggtaaataatataaaaaatcaagtattttttgatcaatattta
ggtccaaattttagaccttggtcggaaacagttatgcttaatggtgagcgggaaacttta
ggaatatatttaacaggtaatcctattacacaatatttaaatgaaattaaatattatact
ggcggagttagtttaaaagacattcattgtctagaacgtggtaaacaggtaacagtagtt
ggtttgattttatcgttgaagataaaagtaactaagcaaggtaataagatttgcatatgt
actataaattatctaaatgaacatttagatgttattatttttaccccaatactacaaaaa
tacaaaaattttttacaaaaagatactattgtgctagtagctggtgaagttagcgttgat
aacgtgacaggaagctgtcagttaattgctataaacattatggatattaacacagcacgt
aaaaaattttcttgtggacttgctatatcgctaactaaacaacaaattaataaagacttt
ttgaaaaatattagtttaactattaaaccacatttatcaggaatcattcctgtgcatatt
tattctaaaatagaaaatgtacgtatacgtatgcgttttggtaccaattggcaggttatg
cctactgacgatttactaaatgatttacgtcttttggtaggtcatgaacaagttcaacta
gaatttgactaa

KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_570
Entry
AB162_570         CDS       T04544                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03030  DNA replication
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    AB162_570 (holD)
   03430 Mismatch repair
    AB162_570 (holD)
   03440 Homologous recombination
    AB162_570 (holD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:bcig03032]
    AB162_570 (holD)
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_570 (holD)
Enzymes [BR:bcig01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     AB162_570 (holD)
DNA replication proteins [BR:bcig03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     AB162_570 (holD)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     AB162_570 (holD)
SSDB
Motif
Pfam: DNA_III_psi
Other DBs
NCBI-ProteinID: AKZ66147
UniProt: A0A0K2BLS9
LinkDB
Position
complement(599991..600422)
AA seq 143 aa
MSIKRELLLKQLGIMQWMLRNYQLLIHSNSSNLEVSLRGNKIKLLIIVDKQIPYAYHPLL
TDVARSMELRPEHLLLITIEQVMMLPNNSHYHCWWLGFTEICKKLNGISLLTPPLSILNN
DATAKRNLWRQIINAKKYFKYTQ
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtcaattaaacgtgaattattattaaaacaactaggtatcatgcaatggatgctacga
aattatcaattattaatacatagtaatagtagtaacttagaagttagcttacggggtaat
aaaataaagttacttataatagtagataagcaaataccatatgcgtatcatccgctacta
actgatgttgcacgtagtatggaacttaggcctgagcacttattattaattactatagaa
caagtaatgatgttacctaataactcacattaccattgttggtggttaggttttacagaa
atttgcaaaaaactcaatggtatttctttattaactccaccattatcaattcttaataat
gatgctacagctaaacgtaatctatggcgtcagattattaatgctaaaaaatattttaag
tatacgcagtga

DBGET integrated database retrieval system