KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_105
Entry
AB162_105         CDS       T04544                                 

Gene name
uvrD
Definition
(GenBank) ATP-dependent DNA helicase UvrD/PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03420  Nucleotide excision repair
bcig03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    AB162_105 (uvrD)
   03430 Mismatch repair
    AB162_105 (uvrD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_105 (uvrD)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     AB162_105 (uvrD)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     AB162_105 (uvrD)
   MMR (mismatch excision repair)
    Other MMR factors
     AB162_105 (uvrD)
SSDB
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 AAA_30 Exonuc_V_gamma Viral_helicase1 AAA_22
Other DBs
NCBI-ProteinID: AKZ65724
UniProt: A0A0K2BKK9
LinkDB
Position
119314..121254
AA seq 646 aa
MHISGLLNSLNNQQRKAVSAPIGNIMVIAGAGSGKTRVIAHRIAWLISVKNCLPSSILAV
TFTNKSAEEMRSRIENIIGDHSSGMWIGTFHSLAYRILRINYINAHLPKNFQVIDSEDQL
KLVKNIIRYLNLDETTWQPCQAMWYINKNKDEGRRPNNINNYYNKFEETWFSIYKIYQEI
CNNTGLVDFAELILRVYEMLINNSNIMQYYRNKFTTILVDEFQDTNNIQYYWIRMLAGNK
GNVTIVGDDDQSIYRWRGAQVENIQRFINDFPKVKIICLEQNYRSTSNILYAANQLIANN
IGSRITKNLWTNNAVGEQITIYCALNELDEAKFVINCIKINKKNGGLLQECAILYRNNAQ
SRVIEESLINMKIPYHIYGGMRFFERQEVKNVLAYLQLISNKNNDAAYERIINIPIRGIG
LRTIEKLRNIACNRQLTLWQASLVLINERMISNKLSLAMQNFITLINELERDTANLPLHM
QTQLVIQKSGLLAMYQKEIGDKDQARIKNIEELITAAKQFYYEDKDMLPLQAFLSHVALE
ETIDKQMFPKDAVQLMTIHSAKGLEFKQVFIVGMEEGIFPSQQALNEQKNIEEERRLAYV
GVTRAMKKLTITYAKKRYLYGQEAYRRRSRFISELPKQCLEQLNYK
NT seq 1941 nt   +upstreamnt  +downstreamnt
atgcatatttctggtctattgaatagtttaaataatcaacaaagaaaagctgtctcagca
ccaataggtaatattatggtaatagctggtgccggtagtggtaaaactagagtgattgca
catcgtattgcatggttaatttcagtaaaaaattgtttgccatcttctattttagcagta
acttttactaataaatcagcagaggagatgcgtagtagaatagaaaatataataggtgat
cattcttctggaatgtggataggaacgtttcatagcttagcataccgtattctacggata
aactatattaatgctcatttacctaaaaattttcaagttatcgatagcgaagatcaacta
aaattagtaaaaaatattattcgttaccttaatttagatgagacaacatggcaaccatgt
caagctatgtggtatataaacaaaaacaaagatgaaggtaggcgtccaaacaatattaat
aattattataacaagtttgaagaaacttggtttagtatttacaaaatttaccaggagata
tgtaataatactggactagtagattttgctgaattaatactaagagtttatgagatgcta
ataaataatagtaatataatgcaatattatcgtaataaatttactacgattttagtagat
gaatttcaagacacaaataatattcagtactactggattagaatgttagcaggtaataaa
ggtaatgtcacaattgttggtgatgatgatcagtccatttatcgttggaggggggcgcaa
gtagaaaatatacagcgttttattaatgattttcctaaagtaaaaattatctgcttggaa
caaaactaccgctctactagtaatattttatatgcagctaatcaattaatcgctaataat
attggtagtagaattactaaaaatctttggacaaacaatgcagtaggagaacaaattact
atatactgcgctcttaatgaactagacgaggcaaaatttgtcattaattgcattaaaatt
aacaaaaaaaatggtggtttactccaagagtgcgcaattctatatcgtaataatgcacaa
tcaagagtgatagaagaatcactaatcaatatgaaaatcccttaccatatatatggtggt
atgcgttttttcgaacgtcaagaagttaaaaatgtactagcttatttgcagttaatttct
aataaaaataatgatgctgcttatgaacgtataattaatatacctattcgtggcataggt
ctaagaactatagaaaaattacgtaatatagcctgtaatagacaactcacattatggcag
gctagtttagtgttaataaatgagagaatgatctctaataaattatctttagctatgcaa
aattttattactctaataaatgaattagagagagatacagccaatttaccattacatatg
cagactcaattagtaatacaaaaatctggcttattggctatgtatcaaaaagaaataggc
gataaagatcaggctcgtattaaaaatattgaagaacttattacggcagctaagcaattt
tactacgaagacaaagatatgctaccgttacaagcttttttgtcccatgttgctctagaa
gagactatagataaacaaatgtttcctaaagatgctgtacaactaatgacaatacattct
gctaaaggtttagaatttaagcaagtatttatcgttgggatggaagagggaatttttcct
agccaacaagctcttaatgaacagaaaaatatcgaagaagagcgacgtttagcttatgta
ggagttactagagcaatgaaaaaactaactattacttatgctaaaaaacgttatctatat
ggtcaggaagcttatcgtcgtcgctcacgttttatcagtgaattacctaaacaatgctta
gaacaattaaattataaataa

DBGET integrated database retrieval system