KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_129
Entry
AB162_129         CDS       T04544                                 

Gene name
recJ
Definition
(GenBank) Single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03410  Base excision repair
bcig03430  Mismatch repair
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    AB162_129 (recJ)
   03430 Mismatch repair
    AB162_129 (recJ)
   03440 Homologous recombination
    AB162_129 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_129 (recJ)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     AB162_129 (recJ)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     AB162_129 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     AB162_129 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      AB162_129 (recJ)
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH
Other DBs
NCBI-ProteinID: AKZ65748
UniProt: A0A0K2BL18
LinkDB
Position
146238..147992
AA seq 584 aa
MFKNYLKVNETHLCRRPLGNISVLSNLNIPPLLKQLYIQRGITKPCELELNIDKLLNYST
ITGIEQAAIILAQAIIDKLNILIVGDYDTDGATSTALVLLSLKKMGAKNINFIIPKRFEE
HHGISPAIVEQALLLNTKIIITVDNGISSYDGVNLASSKGINVLITDHHLPSNKLPLAAA
IVNPNLDSCLFPSKALAGVGVTFYLMLALRAQLYELGWFSKNSIVIPNLVNLLDLVALGT
IADMVPLDTNNRILVFQGIRRIRAGYCCPGIIALAQVAKVNINTLCEHDLSFAISPRLNA
AGRIDDMSLGVTLLTTNNMSKAIILAKQLDQLNKTRKKIEQTMEIQALELCKEIEYKKGD
IPLGLSLYHPKWHHGIIGILASRLKKKFNRPVITFASTSLNLVKGSCRSIEGVNIYQILN
KLNLRYPGMILQFGGHAMAAGLTLEEQKLKIFTNRFENIIKKIIVPSMLKNIIWSDGELT
NDQLSILTAKIIKNGGPWGENFSYPLFDGEFIILNQQIINKKHLIMKLKPITNGPLVSGI
IFNMTNFIKLNCKQNKIKLAYQLNINNFYGKSNLQLLIQYFWKI
NT seq 1755 nt   +upstreamnt  +downstreamnt
atgtttaaaaattatttaaaagttaatgaaactcatttatgtcgtagaccattaggtaat
atttcagttttatctaatttaaacattccaccattactaaaacaactttatatacaacgt
ggtattacaaaaccatgtgaattagaactaaatattgataaattactaaactattctact
atcactggtattgaacaagcagcaataattttagcacaagcgataatagataaacttaac
attctaatagtaggagattatgatactgatggtgcaactagtactgctttagttttactt
tctttaaaaaaaatgggtgcaaaaaacattaattttattattccaaaacgttttgaagaa
catcacggtattagtccagcgatagtagaacaagctttattgcttaatactaaaataatt
attactgttgataatggaatatcatcttatgatggggttaatttagcgtcttctaaaggt
attaatgtattaattactgatcatcatttacctagtaataagttacctttagctgcagct
attgtcaaccctaatttagattcttgtctttttccttcaaaagctttagcaggtgttggt
gttactttttatctaatgctagctttacgtgctcagttatatgagttaggttggttttca
aagaacagtatagtaataccaaatttagtaaatttattagatttagtagcattggggact
atagccgatatggtaccattagatactaataatcgtattttagtatttcaaggtatacgt
cgtattagagctggttactgttgtcctggaataattgcgttagctcaagttgcgaaagtt
aatatcaataccttatgcgaacatgatttaagttttgctattagtccacgcctaaatgct
gcaggacgaatagatgatatgtcattaggagttactttactaacaaccaataacatgtca
aaagctataattttagctaaacaactagatcaactgaataaaactagaaaaaaaattgaa
caaactatggaaattcaagcattagaattatgcaaagaaatagaatataaaaaaggtgat
ataccattaggtttatctctttatcatcccaaatggcaccatggtataataggtatttta
gcttctaggctaaaaaaaaaatttaatagaccagttataacttttgcatctactagtttg
aatttagtaaagggttcttgtcgttctattgaaggtgtaaatatatatcaaatattaaat
aaattaaatttaagatatcctggtatgattttacaatttggtggtcatgctatggccgct
ggtttaactttagaagaacaaaaattaaaaatttttactaatcgttttgaaaacattatt
aaaaaaattattgttccttcaatgctaaaaaatattatttggtctgatggtgaattaact
aatgatcaattatccatattaactgctaaaataataaaaaatggaggaccatggggtgaa
aatttttcctatcctttatttgatggtgaatttattatattaaatcaacaaattataaat
aaaaaacacttaataatgaaactaaaacctattactaatggaccattagtatctggaatt
atttttaatatgacaaattttattaaattaaattgtaaacaaaataaaattaaattagct
tatcagttaaatattaataatttttatggtaaatctaatttacaattattaattcaatat
ttttggaaaatttaa

DBGET integrated database retrieval system