KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_143
Entry
AB162_143         CDS       T04544                                 

Gene name
priA
Definition
(GenBank) Helicase PriA essential for oriC/DnaA-independent DNA replication
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_143 (priA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_143 (priA)
Enzymes [BR:bcig01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AB162_143 (priA)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_143 (priA)
SSDB
Motif
Pfam: PriA_3primeBD PriA_C DEAD ResIII Helicase_C PriA_CRR AAA_30 PIF1 zinc-ribbons_6 Zeta_toxin AAA_19
Other DBs
NCBI-ProteinID: AKZ65756
UniProt: A0A0K2BK08
LinkDB
Position
162132..164333
AA seq 733 aa
MLVVNVALPMPLITTFYYLLPDNLNQAVVGGRVRVPFGKRQVIGIITAINTSINIKLDNI
KLVTEVIDRKSIFSDRLWRFLIWSISYYHYPVGKVLFHSLPMLIRKGKQIENAPILQWCL
TKKGSLTLPNSLTHAPKQKKALILLLSRPLYRHKLKEVQLDHATLQTLRTKGLCKLSANI
CDESDDYWRPILRRNSEQLILNNEQATAVCAINSHNEQYIVWLLAGVTGAGKTEVYIKVL
ENIILKGKQALVLVPEISLTPQTIARFRERFHAPVEVLHSGINEKDKFTVWHKVRCGKSA
IVIGTRSALFSPFAKLGIIVIDEEHDCSYKQHDGWRYNARDLAVVLAREENVPIILGTAT
PALETLYNVKQKKYRQLTLENRVGKAKLANQQLIDLKGKQLTNGLSIELINKMRLHLEAG
NQVMLFLNRRGFAPVLLCHECGWIAECKRCDHYYTVHQKTRQLRCHHCDSKLPVSYQCLQ
CGSTQLIPVGVGTEQIEEALLSKFPNVPVTRIDRDTTAPKGSLELFLSQVNSGGERILIG
TQMLAKGHHFPEVTLVSLLNVDGALFSRDFRAAERFAQLYTQVSGRAGRAGKQGEVLLQT
HYPEHPLLQKLMSYSYIDFARTMLEERRQANLPPYTSHIMFRAEDHNNKNARLFLDQVRH
LLNNTHKDENLLLIGPIPALVPKRSGRFRWQLLLSHPLRIKLQLIVKNIVPLVGTTYQAR
KVKWSIDVDPIDS
NT seq 2202 nt   +upstreamnt  +downstreamnt
atgctagttgttaacgttgctctacctatgccgctaatcacaactttctattatttacta
cctgataacttaaatcaagctgtagtcggaggtagagtacgtgttccattcgggaagcgc
caggttattggtattattaccgcaataaatacaagtataaatataaaactagataatatt
aaattagtaactgaagtaatagatagaaagtctatattttctgatagattatggcgtttt
ttgatttggtcgattagttattatcactatccagttggtaaagttttatttcactcatta
cctatgctgattcgcaaaggtaaacaaatagaaaatgcgcccatattgcaatggtgttta
acaaaaaaaggcagtcttactttaccaaatagtctgacgcatgctcctaagcaaaaaaaa
gcgctaatcttactacttagtaggccgttatatcggcataaattaaaagaggtacaacta
gatcatgcgaccctacagacgctacgtactaaaggattatgtaaattaagtgcaaatatt
tgtgatgaatccgacgattactggcggcctatattgaggagaaatagtgagcaattaata
cttaataatgagcaggcaactgctgtttgtgctattaatagccataatgagcaatatatt
gtttggttactagctggtgtcacaggagcaggtaagacagaagtatatattaaagtacta
gaaaatattatcttaaaaggtaaacaggctttagtcctagtaccagaaattagcctaact
ccgcaaactattgctagatttcgtgagcgtttccatgctccggtagaagtattacattct
ggtataaatgaaaaagacaagttcacggtctggcataaagtacggtgtggaaaaagtgcc
attgttattggtacacgctctgcactattcagtccttttgctaaattaggtataatagtt
atagacgaagaacatgattgctcatataagcagcatgatggctggcgttataacgctcgt
gatctagcagtagtattagctcgcgaggaaaatgtcccaattatccttgggacagctacg
ccagctttagagacactttataatgtaaaacaaaaaaaataccgtcaattaacgctagaa
aatcgtgttggaaaagcaaaactagcaaatcagcaattaatagatttaaaaggcaagcaa
ctaactaatggattatcaatagaactaataaacaaaatgagactgcacttagaagcaggt
aaccaggtgatgctatttcttaatagacgcgggtttgctcctgtactactatgtcatgaa
tgcggttggatagccgagtgtaagcggtgtgatcactactatactgttcatcagaaaaca
cgtcagttacgatgtcatcactgtgatagtaagctcccagtatcatatcaatgtttacaa
tgcggttctactcagcttataccagtaggtgtaggcacagagcaaattgaagaggctcta
ttaagtaaatttcctaacgttcctgtgacacgcatagatcgtgatactactgcacctaaa
ggatcactggaattgtttttatcccaagtgaatagtggtggtgagcgtattttaataggt
acgcaaatgctagcaaaagggcatcattttccagaagtaactttagtatcattattaaat
gtagacggagcgctattttctagagattttcgcgctgccgagagatttgctcaactttat
actcaggtatcaggtcgcgctggtagagctggtaaacaaggagaagttttattacaaacc
cattatcctgagcatccactactacagaaactaatgagttatagctatatagactttgcc
agaacgatgttagaagaacgtagacaggctaacttaccaccttataccagtcatataatg
tttcgcgctgaagatcataacaataaaaatgctagattatttctagaccaagtgagacac
ttgttaaataatacgcataaagatgaaaatttattactaataggacctataccagcatta
gtaccaaagcgtagtggtaggtttcgttggcaactattattgtcacatccattgcgaatc
aaattgcagctaattgtgaaaaatattgttccattagtaggaacaacttatcaagcacgt
aaagtaaaatggtctatagatgttgatcctatagacagctga

DBGET integrated database retrieval system