KEGG   Candidatus Baumannia cicadellinicola B-GSS: AB162_181
Entry
AB162_181         CDS       T04544                                 

Gene name
recA
Definition
(GenBank) RecA protein
  KO
K03553  recombination protein RecA
Organism
bcig  Candidatus Baumannia cicadellinicola B-GSS
Pathway
bcig03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bcig00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AB162_181 (recA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:bcig03400]
    AB162_181 (recA)
DNA repair and recombination proteins [BR:bcig03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AB162_181 (recA)
    RecFOR pathway proteins
     AB162_181 (recA)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AB162_181 (recA)
SSDB
Motif
Pfam: RecA Rad51 ATPase ATPase_2 AAA_24 AAA_25 AAA_16 AAA_22 AAA_35 PAXNEB AAA AAA_14 MobB ABC_tran CobU CbiA TK
Other DBs
NCBI-ProteinID: AKZ65786
UniProt: A0A0K2BK33
LinkDB
Position
complement(192360..193340)
AA seq 326 aa
MRLGEDRSMNIETISTGSLSLDIALGAGGLPMGRIVEIYGPESSGKTTLTLQVIATAQKE
GKICAFIDAEHALDPIYAKKLGVDIDNLLCSQPDTGEQALEICDVLTRSRAVDVIIVDSV
AALAPKAEIEGEIGDSHVGLAARMMSQAMRKLTGNLKNANTLLIFINQIRMKIGVMFGNL
ETTTGGNALKFYSSVRLDIRRIGSVKEGDVVIGSETRVKVVKNKVAAPFKQAEFQIKYGE
GINIYGELVDLGVKNNIIEKAGSWYSYNGEKIGQGKTNVCNFLKYNQQLSAEINKKLREM
LLHTTTSTDTDSKFLYEEDNSKERYE
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcgcctaggtgaagatcgctccatgaatatagaaactatttccacaggttcgctatct
cttgatattgcattgggcgcaggtggtttacctatgggtcgtattgtagaaatatatgga
ccagaatcgtcaggtaaaacaacattaacgctacaagtaatagccactgcacagaaagaa
ggtaaaatatgcgcatttatagatgctgaacatgcactagatcccatttatgcaaaaaaa
ttaggggtagatatcgataacctactgtgctcacaaccagatacaggagaacaggcatta
gaaatatgtgacgtattaactagatctagagcagtagatgtaattatcgttgattcagta
gctgcgttagcacctaaggccgagatagaaggagaaattggagattcgcacgttggtcta
gctgcgcgtatgatgagccaggcaatgcgtaaactaactggtaacctaaaaaatgctaat
actttactaatatttattaatcaaattagaatgaagataggtgttatgtttggtaatcta
gaaactactactggtggtaacgcgctaaaattttattcttctgttagactagatattcga
cgtataggttctgtgaaagagggagatgtagttattggtagtgaaacacgcgtaaaagta
gtaaaaaataaagttgccgcgccatttaaacaggctgaatttcagattaaatacggcgaa
ggaataaatatttacggtgaactagtagatttaggtgtaaagaataatataattgaaaaa
gcaggttcttggtatagttataatggcgaaaaaattggacagggaaagactaacgtctgt
aactttctaaaatataatcagcaactttcagcagaaattaataaaaaactcagagagatg
ttactgcatactacaacaagtaccgataccgatagtaaatttttatatgaagaagataac
tccaaagaacgctatgaataa

DBGET integrated database retrieval system